From 9fc395b4cdb7ef02179d196fbedbfa6f2c635ab8 Mon Sep 17 00:00:00 2001 From: github-actions-bot Date: Tue, 10 Dec 2024 13:09:10 +0000 Subject: [PATCH] Updates --- 1c-enterprise/daily/index.xml | 2 +- 2-dimensional-array/daily/index.xml | 2 +- 4d/daily/index.xml | 2 +- abap-cds/daily/index.xml | 2 +- abap/daily/index.xml | 2 +- abnf/daily/index.xml | 2 +- actionscript/daily/index.xml | 2 +- ada/daily/index.xml | 2 +- adobe-font-metrics/daily/index.xml | 2 +- agda/daily/index.xml | 2 +- ags-script/daily/index.xml | 2 +- aidl/daily/index.xml | 2 +- al/daily/index.xml | 2 +- all/daily/index.xml | 32 +++++++++---------- alloy/daily/index.xml | 2 +- alpine-abuild/daily/index.xml | 2 +- altium-designer/daily/index.xml | 2 +- ampl/daily/index.xml | 2 +- angelscript/daily/index.xml | 2 +- ant-build-system/daily/index.xml | 2 +- antlr/daily/index.xml | 2 +- apacheconf/daily/index.xml | 2 +- apex/daily/index.xml | 2 +- api-blueprint/daily/index.xml | 2 +- apl/daily/index.xml | 2 +- apollo-guidance-computer/daily/index.xml | 2 +- applescript/daily/index.xml | 2 +- arc/daily/index.xml | 2 +- asciidoc/daily/index.xml | 2 +- asl/daily/index.xml | 2 +- asn.1/daily/index.xml | 2 +- asp.net/daily/index.xml | 2 +- aspectj/daily/index.xml | 2 +- assembly/daily/index.xml | 2 +- astro/daily/index.xml | 2 +- asymptote/daily/index.xml | 2 +- ats/daily/index.xml | 2 +- augeas/daily/index.xml | 2 +- autohotkey/daily/index.xml | 2 +- autoit/daily/index.xml | 2 +- avro-idl/daily/index.xml | 2 +- awk/daily/index.xml | 2 +- ballerina/daily/index.xml | 2 +- basic/daily/index.xml | 2 +- batchfile/daily/index.xml | 2 +- beef/daily/index.xml | 2 +- befunge/daily/index.xml | 2 +- berry/daily/index.xml | 2 +- bibtex/daily/index.xml | 2 +- bicep/daily/index.xml | 9 +++++- bison/daily/index.xml | 2 +- bitbake/daily/index.xml | 2 +- blade/daily/index.xml | 2 +- blitzbasic/daily/index.xml | 2 +- blitzmax/daily/index.xml | 2 +- bluespec/daily/index.xml | 2 +- boo/daily/index.xml | 2 +- boogie/daily/index.xml | 2 +- brainfuck/daily/index.xml | 2 +- brightscript/daily/index.xml | 2 +- browserslist/daily/index.xml | 2 +- c%23/daily/index.xml | 2 +- c++/daily/index.xml | 9 +----- c-objdump/daily/index.xml | 2 +- c/daily/index.xml | 2 +- c2hs-haskell/daily/index.xml | 2 +- cabal-config/daily/index.xml | 2 +- cadence/daily/index.xml | 2 +- cairo/daily/index.xml | 2 +- cap'n-proto/daily/index.xml | 2 +- cartocss/daily/index.xml | 2 +- ceylon/daily/index.xml | 2 +- chapel/daily/index.xml | 2 +- charity/daily/index.xml | 2 +- chuck/daily/index.xml | 2 +- cil/daily/index.xml | 2 +- cirru/daily/index.xml | 2 +- clarion/daily/index.xml | 2 +- clarity/daily/index.xml | 2 +- classic-asp/daily/index.xml | 2 +- clean/daily/index.xml | 2 +- click/daily/index.xml | 2 +- clips/daily/index.xml | 2 +- clojure/daily/index.xml | 2 +- closure-templates/daily/index.xml | 2 +- .../daily/index.xml | 2 +- cmake/daily/index.xml | 2 +- cobol/daily/index.xml | 2 +- codeowners/daily/index.xml | 2 +- codeql/daily/index.xml | 2 +- coffeescript/daily/index.xml | 2 +- coldfusion-cfc/daily/index.xml | 2 +- coldfusion/daily/index.xml | 2 +- collada/daily/index.xml | 2 +- common-lisp/daily/index.xml | 2 +- common-workflow-language/daily/index.xml | 2 +- component-pascal/daily/index.xml | 2 +- conll-u/daily/index.xml | 2 +- cool/daily/index.xml | 2 +- coq/daily/index.xml | 2 +- cpp-objdump/daily/index.xml | 2 +- creole/daily/index.xml | 2 +- crystal/daily/index.xml | 2 +- cson/daily/index.xml | 2 +- csound-document/daily/index.xml | 2 +- csound-score/daily/index.xml | 2 +- csound/daily/index.xml | 2 +- css/daily/index.xml | 2 +- csv/daily/index.xml | 2 +- cuda/daily/index.xml | 2 +- cue/daily/index.xml | 2 +- curl-config/daily/index.xml | 2 +- curry/daily/index.xml | 2 +- cweb/daily/index.xml | 2 +- cycript/daily/index.xml | 2 +- cython/daily/index.xml | 2 +- d-objdump/daily/index.xml | 2 +- d/daily/index.xml | 2 +- dafny/daily/index.xml | 2 +- darcs-patch/daily/index.xml | 2 +- dart/daily/index.xml | 2 +- dataweave/daily/index.xml | 2 +- debian-package-control-file/daily/index.xml | 2 +- denizenscript/daily/index.xml | 2 +- desktop/daily/index.xml | 2 +- dhall/daily/index.xml | 2 +- diff/daily/index.xml | 2 +- digital-command-language/daily/index.xml | 2 +- dircolors/daily/index.xml | 2 +- directx-3d-file/daily/index.xml | 2 +- dm/daily/index.xml | 2 +- dns-zone/daily/index.xml | 2 +- dockerfile/daily/index.xml | 2 +- dogescript/daily/index.xml | 2 +- dtrace/daily/index.xml | 2 +- dylan/daily/index.xml | 2 +- e-mail/daily/index.xml | 2 +- e/daily/index.xml | 2 +- eagle/daily/index.xml | 2 +- earthly/daily/index.xml | 2 +- easybuild/daily/index.xml | 2 +- ebnf/daily/index.xml | 2 +- ec/daily/index.xml | 2 +- ecere-projects/daily/index.xml | 2 +- ecl/daily/index.xml | 2 +- eclipse/daily/index.xml | 2 +- editorconfig/daily/index.xml | 2 +- edje-data-collection/daily/index.xml | 2 +- edn/daily/index.xml | 2 +- eiffel/daily/index.xml | 2 +- ejs/daily/index.xml | 2 +- elixir/daily/index.xml | 2 +- elm/daily/index.xml | 2 +- emacs-lisp/daily/index.xml | 2 +- emberscript/daily/index.xml | 2 +- eq/daily/index.xml | 2 +- erlang/daily/index.xml | 9 +----- euphoria/daily/index.xml | 2 +- f%23/daily/index.xml | 2 +- f*/daily/index.xml | 2 +- factor/daily/index.xml | 2 +- fancy/daily/index.xml | 2 +- fantom/daily/index.xml | 2 +- faust/daily/index.xml | 2 +- fennel/daily/index.xml | 2 +- figlet-font/daily/index.xml | 2 +- filebench-wml/daily/index.xml | 2 +- filterscript/daily/index.xml | 2 +- fish/daily/index.xml | 2 +- fluent/daily/index.xml | 2 +- flux/daily/index.xml | 2 +- formatted/daily/index.xml | 2 +- forth/daily/index.xml | 2 +- fortran-free-form/daily/index.xml | 2 +- fortran/daily/index.xml | 2 +- freebasic/daily/index.xml | 2 +- freemarker/daily/index.xml | 2 +- frege/daily/index.xml | 2 +- futhark/daily/index.xml | 2 +- g-code/daily/index.xml | 2 +- game-maker-language/daily/index.xml | 2 +- gaml/daily/index.xml | 2 +- gams/daily/index.xml | 2 +- gap/daily/index.xml | 2 +- gcc-machine-description/daily/index.xml | 2 +- gdb/daily/index.xml | 2 +- gdscript/daily/index.xml | 2 +- gedcom/daily/index.xml | 2 +- gemfile.lock/daily/index.xml | 2 +- genie/daily/index.xml | 2 +- genshi/daily/index.xml | 2 +- gentoo-ebuild/daily/index.xml | 2 +- gentoo-eclass/daily/index.xml | 2 +- gerber-image/daily/index.xml | 2 +- gettext-catalog/daily/index.xml | 2 +- gherkin/daily/index.xml | 2 +- git-attributes/daily/index.xml | 2 +- git-config/daily/index.xml | 2 +- gleam/daily/index.xml | 2 +- glsl/daily/index.xml | 2 +- .../daily/index.xml | 2 +- glyph/daily/index.xml | 2 +- gn/daily/index.xml | 2 +- gnuplot/daily/index.xml | 2 +- go-checksums/daily/index.xml | 2 +- go-module/daily/index.xml | 2 +- go/daily/index.xml | 9 +++++- golo/daily/index.xml | 2 +- gosu/daily/index.xml | 2 +- grace/daily/index.xml | 2 +- gradle/daily/index.xml | 2 +- grammatical-framework/daily/index.xml | 2 +- graph-modeling-language/daily/index.xml | 2 +- graphql/daily/index.xml | 2 +- graphviz-(dot)/daily/index.xml | 2 +- groovy-server-pages/daily/index.xml | 2 +- groovy/daily/index.xml | 2 +- gsc/daily/index.xml | 2 +- hack/daily/index.xml | 2 +- haml/daily/index.xml | 2 +- handlebars/daily/index.xml | 2 +- haproxy/daily/index.xml | 2 +- harbour/daily/index.xml | 2 +- haskell/daily/index.xml | 2 +- haxe/daily/index.xml | 9 +++++- hcl/daily/index.xml | 9 +----- hiveql/daily/index.xml | 2 +- hlsl/daily/index.xml | 2 +- holyc/daily/index.xml | 2 +- hoon/daily/index.xml | 2 +- html+ecr/daily/index.xml | 2 +- html+eex/daily/index.xml | 2 +- html+erb/daily/index.xml | 2 +- html+php/daily/index.xml | 2 +- html+razor/daily/index.xml | 2 +- html/daily/index.xml | 2 +- http/daily/index.xml | 2 +- hxml/daily/index.xml | 2 +- hy/daily/index.xml | 2 +- hyphy/daily/index.xml | 2 +- idl/daily/index.xml | 2 +- idris/daily/index.xml | 2 +- ignore-list/daily/index.xml | 2 +- igor-pro/daily/index.xml | 2 +- imagej-macro/daily/index.xml | 2 +- inform-7/daily/index.xml | 2 +- ini/daily/index.xml | 2 +- inno-setup/daily/index.xml | 2 +- io/daily/index.xml | 2 +- ioke/daily/index.xml | 2 +- irc-log/daily/index.xml | 2 +- isabelle-root/daily/index.xml | 2 +- isabelle/daily/index.xml | 2 +- j/daily/index.xml | 2 +- janet/daily/index.xml | 2 +- jar-manifest/daily/index.xml | 2 +- jasmin/daily/index.xml | 2 +- java-properties/daily/index.xml | 2 +- java-server-pages/daily/index.xml | 2 +- java/daily/index.xml | 2 +- javascript+erb/daily/index.xml | 2 +- javascript/daily/index.xml | 2 +- jest-snapshot/daily/index.xml | 2 +- jflex/daily/index.xml | 2 +- jinja/daily/index.xml | 2 +- jison-lex/daily/index.xml | 2 +- jison/daily/index.xml | 2 +- jolie/daily/index.xml | 2 +- jq/daily/index.xml | 2 +- json-with-comments/daily/index.xml | 2 +- json/daily/index.xml | 2 +- json5/daily/index.xml | 2 +- jsoniq/daily/index.xml | 2 +- jsonld/daily/index.xml | 2 +- jsonnet/daily/index.xml | 2 +- julia/daily/index.xml | 2 +- jupyter-notebook/daily/index.xml | 2 +- kaitai-struct/daily/index.xml | 2 +- kakounescript/daily/index.xml | 2 +- kicad-layout/daily/index.xml | 2 +- kicad-legacy-layout/daily/index.xml | 2 +- kicad-schematic/daily/index.xml | 2 +- kit/daily/index.xml | 2 +- kotlin/daily/index.xml | 2 +- krl/daily/index.xml | 2 +- kusto/daily/index.xml | 2 +- kvlang/daily/index.xml | 2 +- labview/daily/index.xml | 2 +- lark/daily/index.xml | 2 +- lasso/daily/index.xml | 2 +- latte/daily/index.xml | 2 +- lean/daily/index.xml | 2 +- less/daily/index.xml | 2 +- lex/daily/index.xml | 2 +- lfe/daily/index.xml | 2 +- ligolang/daily/index.xml | 2 +- lilypond/daily/index.xml | 2 +- limbo/daily/index.xml | 2 +- linker-script/daily/index.xml | 2 +- linux-kernel-module/daily/index.xml | 2 +- liquid/daily/index.xml | 2 +- literate-agda/daily/index.xml | 2 +- literate-coffeescript/daily/index.xml | 2 +- literate-haskell/daily/index.xml | 2 +- livescript/daily/index.xml | 2 +- llvm/daily/index.xml | 2 +- logos/daily/index.xml | 2 +- logtalk/daily/index.xml | 2 +- lolcode/daily/index.xml | 2 +- lookml/daily/index.xml | 2 +- loomscript/daily/index.xml | 2 +- lsl/daily/index.xml | 2 +- ltspice-symbol/daily/index.xml | 2 +- lua/daily/index.xml | 2 +- m/daily/index.xml | 2 +- m4/daily/index.xml | 2 +- m4sugar/daily/index.xml | 2 +- macaulay2/daily/index.xml | 2 +- makefile/daily/index.xml | 7 ---- mako/daily/index.xml | 2 +- markdown/daily/index.xml | 2 +- marko/daily/index.xml | 2 +- mask/daily/index.xml | 2 +- mathematica/daily/index.xml | 2 +- matlab/daily/index.xml | 9 +++++- maven-pom/daily/index.xml | 2 +- max/daily/index.xml | 2 +- maxscript/daily/index.xml | 2 +- mcfunction/daily/index.xml | 2 +- mercury/daily/index.xml | 2 +- meson/daily/index.xml | 2 +- metal/daily/index.xml | 2 +- .../daily/index.xml | 2 +- .../daily/index.xml | 2 +- minid/daily/index.xml | 2 +- mint/daily/index.xml | 2 +- mirah/daily/index.xml | 2 +- mirc-script/daily/index.xml | 2 +- mlir/daily/index.xml | 2 +- modelica/daily/index.xml | 2 +- modula-2/daily/index.xml | 2 +- modula-3/daily/index.xml | 2 +- module-management-system/daily/index.xml | 2 +- monkey-c/daily/index.xml | 2 +- monkey/daily/index.xml | 2 +- moocode/daily/index.xml | 2 +- moonscript/daily/index.xml | 2 +- motoko/daily/index.xml | 2 +- motorola-68k-assembly/daily/index.xml | 2 +- mql4/daily/index.xml | 2 +- mql5/daily/index.xml | 2 +- mtml/daily/index.xml | 2 +- muf/daily/index.xml | 2 +- mupad/daily/index.xml | 2 +- muse/daily/index.xml | 2 +- mustache/daily/index.xml | 2 +- myghty/daily/index.xml | 2 +- nanorc/daily/index.xml | 2 +- nasl/daily/index.xml | 2 +- ncl/daily/index.xml | 2 +- nearley/daily/index.xml | 2 +- nemerle/daily/index.xml | 2 +- neon/daily/index.xml | 2 +- nesc/daily/index.xml | 2 +- netlinx+erb/daily/index.xml | 2 +- netlinx/daily/index.xml | 2 +- netlogo/daily/index.xml | 2 +- newlisp/daily/index.xml | 2 +- nextflow/daily/index.xml | 2 +- nginx/daily/index.xml | 2 +- nim/daily/index.xml | 9 +----- ninja/daily/index.xml | 2 +- nit/daily/index.xml | 2 +- nix/daily/index.xml | 2 +- nl/daily/index.xml | 2 +- npm-config/daily/index.xml | 2 +- nsis/daily/index.xml | 2 +- nu/daily/index.xml | 2 +- numpy/daily/index.xml | 2 +- nunjucks/daily/index.xml | 2 +- nwscript/daily/index.xml | 2 +- objdump/daily/index.xml | 2 +- object-data-instance-notation/daily/index.xml | 2 +- objective-c++/daily/index.xml | 2 +- objective-c/daily/index.xml | 2 +- objective-j/daily/index.xml | 2 +- objectscript/daily/index.xml | 2 +- ocaml/daily/index.xml | 2 +- odin/daily/index.xml | 2 +- omgrofl/daily/index.xml | 2 +- ooc/daily/index.xml | 2 +- opa/daily/index.xml | 2 +- opal/daily/index.xml | 2 +- open-policy-agent/daily/index.xml | 2 +- opencl/daily/index.xml | 2 +- openedge-abl/daily/index.xml | 2 +- openqasm/daily/index.xml | 2 +- openrc-runscript/daily/index.xml | 2 +- openscad/daily/index.xml | 2 +- openstep-property-list/daily/index.xml | 2 +- opentype-feature-file/daily/index.xml | 2 +- org/daily/index.xml | 2 +- ox/daily/index.xml | 2 +- oxygene/daily/index.xml | 2 +- oz/daily/index.xml | 2 +- p4/daily/index.xml | 2 +- pan/daily/index.xml | 2 +- papyrus/daily/index.xml | 2 +- parrot-assembly/daily/index.xml | 2 +- .../daily/index.xml | 2 +- parrot/daily/index.xml | 2 +- pascal/daily/index.xml | 2 +- pawn/daily/index.xml | 2 +- peg.js/daily/index.xml | 2 +- pep8/daily/index.xml | 2 +- perl/daily/index.xml | 2 +- php/daily/index.xml | 2 +- pic/daily/index.xml | 2 +- pickle/daily/index.xml | 2 +- picolisp/daily/index.xml | 2 +- piglatin/daily/index.xml | 2 +- pike/daily/index.xml | 2 +- plantuml/daily/index.xml | 2 +- plpgsql/daily/index.xml | 2 +- plsql/daily/index.xml | 2 +- pod-6/daily/index.xml | 2 +- pod/daily/index.xml | 2 +- pogoscript/daily/index.xml | 2 +- pony/daily/index.xml | 2 +- postcss/daily/index.xml | 2 +- postscript/daily/index.xml | 2 +- pov-ray-sdl/daily/index.xml | 2 +- powerbuilder/daily/index.xml | 2 +- powershell/daily/index.xml | 2 +- prisma/daily/index.xml | 2 +- processing/daily/index.xml | 2 +- procfile/daily/index.xml | 2 +- proguard/daily/index.xml | 2 +- prolog/daily/index.xml | 2 +- promela/daily/index.xml | 2 +- propeller-spin/daily/index.xml | 2 +- protocol-buffer-text-format/daily/index.xml | 2 +- protocol-buffer/daily/index.xml | 2 +- public-key/daily/index.xml | 2 +- pug/daily/index.xml | 2 +- puppet/daily/index.xml | 2 +- pure-data/daily/index.xml | 2 +- purebasic/daily/index.xml | 2 +- purescript/daily/index.xml | 2 +- python-console/daily/index.xml | 2 +- python-traceback/daily/index.xml | 2 +- python/daily/index.xml | 12 +++---- q%23/daily/index.xml | 2 +- q/daily/index.xml | 2 +- qmake/daily/index.xml | 2 +- qml/daily/index.xml | 9 +----- qt-script/daily/index.xml | 2 +- quake/daily/index.xml | 2 +- r/daily/index.xml | 2 +- racket/daily/index.xml | 2 +- ragel/daily/index.xml | 2 +- raku/daily/index.xml | 2 +- raml/daily/index.xml | 2 +- rascal/daily/index.xml | 2 +- raw-token-data/daily/index.xml | 2 +- rdoc/daily/index.xml | 2 +- readline-config/daily/index.xml | 2 +- realbasic/daily/index.xml | 2 +- reason/daily/index.xml | 2 +- rebol/daily/index.xml | 2 +- record-jar/daily/index.xml | 2 +- red/daily/index.xml | 2 +- redcode/daily/index.xml | 2 +- redirect-rules/daily/index.xml | 2 +- regular-expression/daily/index.xml | 2 +- ren'py/daily/index.xml | 2 +- renderscript/daily/index.xml | 2 +- rescript/daily/index.xml | 2 +- restructuredtext/daily/index.xml | 2 +- rexx/daily/index.xml | 2 +- rich-text-format/daily/index.xml | 2 +- ring/daily/index.xml | 2 +- riot/daily/index.xml | 2 +- rmarkdown/daily/index.xml | 2 +- robotframework/daily/index.xml | 2 +- robots.txt/daily/index.xml | 2 +- roff-manpage/daily/index.xml | 2 +- roff/daily/index.xml | 2 +- rouge/daily/index.xml | 2 +- rpc/daily/index.xml | 2 +- rpgle/daily/index.xml | 2 +- rpm-spec/daily/index.xml | 2 +- ruby/daily/index.xml | 9 +++++- runoff/daily/index.xml | 2 +- rust/daily/index.xml | 16 +++++++++- sage/daily/index.xml | 2 +- saltstack/daily/index.xml | 2 +- sas/daily/index.xml | 2 +- sass/daily/index.xml | 2 +- scala/daily/index.xml | 9 +----- scaml/daily/index.xml | 2 +- scheme/daily/index.xml | 2 +- scilab/daily/index.xml | 2 +- scss/daily/index.xml | 2 +- sed/daily/index.xml | 2 +- self/daily/index.xml | 2 +- selinux-policy/daily/index.xml | 2 +- shaderlab/daily/index.xml | 2 +- shell/daily/index.xml | 2 +- shellcheck-config/daily/index.xml | 2 +- shellsession/daily/index.xml | 2 +- shen/daily/index.xml | 2 +- sieve/daily/index.xml | 2 +- singularity/daily/index.xml | 2 +- slash/daily/index.xml | 2 +- slice/daily/index.xml | 2 +- slim/daily/index.xml | 2 +- smali/daily/index.xml | 2 +- smalltalk/daily/index.xml | 2 +- smarty/daily/index.xml | 2 +- smpl/daily/index.xml | 2 +- smt/daily/index.xml | 2 +- solidity/daily/index.xml | 2 +- soong/daily/index.xml | 2 +- sourcepawn/daily/index.xml | 2 +- sparql/daily/index.xml | 2 +- spline-font-database/daily/index.xml | 2 +- sqf/daily/index.xml | 2 +- sql/daily/index.xml | 2 +- sqlpl/daily/index.xml | 2 +- squirrel/daily/index.xml | 2 +- srecode-template/daily/index.xml | 2 +- ssh-config/daily/index.xml | 2 +- stan/daily/index.xml | 2 +- standard-ml/daily/index.xml | 2 +- starlark/daily/index.xml | 2 +- stata/daily/index.xml | 2 +- ston/daily/index.xml | 2 +- stringtemplate/daily/index.xml | 2 +- stylus/daily/index.xml | 2 +- subrip-text/daily/index.xml | 2 +- sugarss/daily/index.xml | 2 +- supercollider/daily/index.xml | 2 +- svelte/daily/index.xml | 2 +- svg/daily/index.xml | 2 +- swift/daily/index.xml | 9 +++++- swig/daily/index.xml | 2 +- systemverilog/daily/index.xml | 2 +- talon/daily/index.xml | 2 +- tcl/daily/index.xml | 2 +- tcsh/daily/index.xml | 2 +- tea/daily/index.xml | 2 +- terra/daily/index.xml | 2 +- tex/daily/index.xml | 2 +- texinfo/daily/index.xml | 2 +- text/daily/index.xml | 2 +- textile/daily/index.xml | 2 +- textmate-properties/daily/index.xml | 2 +- thrift/daily/index.xml | 2 +- ti-program/daily/index.xml | 2 +- tla/daily/index.xml | 2 +- toml/daily/index.xml | 2 +- tsql/daily/index.xml | 2 +- tsv/daily/index.xml | 2 +- tsx/daily/index.xml | 2 +- turing/daily/index.xml | 2 +- turtle/daily/index.xml | 2 +- twig/daily/index.xml | 2 +- txl/daily/index.xml | 2 +- type-language/daily/index.xml | 2 +- typescript/daily/index.xml | 16 +--------- unified-parallel-c/daily/index.xml | 2 +- unity3d-asset/daily/index.xml | 2 +- unix-assembly/daily/index.xml | 2 +- unknown/daily/index.xml | 2 +- uno/daily/index.xml | 2 +- unrealscript/daily/index.xml | 2 +- urweb/daily/index.xml | 2 +- v/daily/index.xml | 2 +- vala/daily/index.xml | 2 +- valve-data-format/daily/index.xml | 2 +- vba/daily/index.xml | 2 +- vbscript/daily/index.xml | 2 +- vcl/daily/index.xml | 2 +- verilog/daily/index.xml | 2 +- vhdl/daily/index.xml | 2 +- vim-help-file/daily/index.xml | 2 +- vim-script/daily/index.xml | 2 +- vim-snippet/daily/index.xml | 2 +- visual-basic-.net/daily/index.xml | 2 +- volt/daily/index.xml | 2 +- vue/daily/index.xml | 9 +++++- vyper/daily/index.xml | 2 +- wavefront-material/daily/index.xml | 2 +- wavefront-object/daily/index.xml | 2 +- wdl/daily/index.xml | 2 +- web-ontology-language/daily/index.xml | 2 +- webassembly/daily/index.xml | 2 +- webidl/daily/index.xml | 2 +- webvtt/daily/index.xml | 2 +- wget-config/daily/index.xml | 2 +- wikitext/daily/index.xml | 2 +- windows-registry-entries/daily/index.xml | 2 +- wisp/daily/index.xml | 2 +- witcher-script/daily/index.xml | 2 +- wollok/daily/index.xml | 2 +- world-of-warcraft-addon-data/daily/index.xml | 2 +- x-bitmap/daily/index.xml | 2 +- x-font-directory-index/daily/index.xml | 2 +- x-pixmap/daily/index.xml | 2 +- x10/daily/index.xml | 2 +- xbase/daily/index.xml | 2 +- xc/daily/index.xml | 2 +- xcompose/daily/index.xml | 2 +- xml-property-list/daily/index.xml | 2 +- xml/daily/index.xml | 2 +- xojo/daily/index.xml | 2 +- xonsh/daily/index.xml | 2 +- xpages/daily/index.xml | 2 +- xproc/daily/index.xml | 2 +- xquery/daily/index.xml | 2 +- xs/daily/index.xml | 2 +- xslt/daily/index.xml | 2 +- xtend/daily/index.xml | 2 +- yacc/daily/index.xml | 2 +- yaml/daily/index.xml | 2 +- yang/daily/index.xml | 2 +- yara/daily/index.xml | 2 +- yasnippet/daily/index.xml | 2 +- zap/daily/index.xml | 2 +- zeek/daily/index.xml | 2 +- zenscript/daily/index.xml | 2 +- zephir/daily/index.xml | 2 +- zig/daily/index.xml | 2 +- zil/daily/index.xml | 2 +- zimpl/daily/index.xml | 2 +- 636 files changed, 718 insertions(+), 718 deletions(-) delete mode 100644 makefile/daily/index.xml diff --git a/1c-enterprise/daily/index.xml b/1c-enterprise/daily/index.xml index f206bb7edc7..8a99583fe6e 100644 --- a/1c-enterprise/daily/index.xml +++ b/1c-enterprise/daily/index.xml @@ -1,7 +1,7 @@ GitHub 1C Enterprise Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:28:54Z + 2024-12-10T01:28:43Z Daily Trending of 1C Enterprise in GitHub \ No newline at end of file diff --git a/2-dimensional-array/daily/index.xml b/2-dimensional-array/daily/index.xml index 24d45b05ee1..3362ffb739d 100644 --- a/2-dimensional-array/daily/index.xml +++ b/2-dimensional-array/daily/index.xml @@ -1,7 +1,7 @@ GitHub 2-Dimensional Array Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:28:54Z + 2024-12-10T01:28:43Z Daily Trending of 2-Dimensional Array in GitHub \ No newline at end of file diff --git a/4d/daily/index.xml b/4d/daily/index.xml index 250906d8bef..ea3a11435e2 100644 --- a/4d/daily/index.xml +++ b/4d/daily/index.xml @@ -1,7 +1,7 @@ GitHub 4D Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:00Z + 2024-12-10T01:28:49Z Daily Trending of 4D in GitHub \ No newline at end of file diff --git a/abap-cds/daily/index.xml b/abap-cds/daily/index.xml index d34ed8ca74e..01c456c6aec 100644 --- a/abap-cds/daily/index.xml +++ b/abap-cds/daily/index.xml @@ -1,7 +1,7 @@ GitHub ABAP CDS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:28:59Z + 2024-12-10T01:28:49Z Daily Trending of ABAP CDS in GitHub \ No newline at end of file diff --git a/abap/daily/index.xml b/abap/daily/index.xml index 57b82b50de8..706aa5ee65c 100644 --- a/abap/daily/index.xml +++ b/abap/daily/index.xml @@ -1,7 +1,7 @@ GitHub ABAP Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:28:59Z + 2024-12-10T01:28:50Z Daily Trending of ABAP in GitHub \ No newline at end of file diff --git a/abnf/daily/index.xml b/abnf/daily/index.xml index fe83b78d5f3..1c2e1dd88b3 100644 --- a/abnf/daily/index.xml +++ b/abnf/daily/index.xml @@ -1,7 +1,7 @@ GitHub ABNF Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:28:59Z + 2024-12-10T01:28:50Z Daily Trending of ABNF in GitHub \ No newline at end of file diff --git a/actionscript/daily/index.xml b/actionscript/daily/index.xml index 1f69956796a..3ba18f7ea86 100644 --- a/actionscript/daily/index.xml +++ b/actionscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub ActionScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:00Z + 2024-12-10T01:28:51Z Daily Trending of ActionScript in GitHub \ No newline at end of file diff --git a/ada/daily/index.xml b/ada/daily/index.xml index 73a923b3ce1..581e7650c0b 100644 --- a/ada/daily/index.xml +++ b/ada/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ada Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:01Z + 2024-12-10T01:28:51Z Daily Trending of Ada in GitHub \ No newline at end of file diff --git a/adobe-font-metrics/daily/index.xml b/adobe-font-metrics/daily/index.xml index cf51e7ff7d5..08771f9e1ed 100644 --- a/adobe-font-metrics/daily/index.xml +++ b/adobe-font-metrics/daily/index.xml @@ -1,7 +1,7 @@ GitHub Adobe Font Metrics Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:01Z + 2024-12-10T01:28:51Z Daily Trending of Adobe Font Metrics in GitHub \ No newline at end of file diff --git a/agda/daily/index.xml b/agda/daily/index.xml index fa0ec590d8c..3e5d346dd64 100644 --- a/agda/daily/index.xml +++ b/agda/daily/index.xml @@ -1,7 +1,7 @@ GitHub Agda Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:03Z + 2024-12-10T01:28:53Z Daily Trending of Agda in GitHub \ No newline at end of file diff --git a/ags-script/daily/index.xml b/ags-script/daily/index.xml index b80d923782f..2c08949d39c 100644 --- a/ags-script/daily/index.xml +++ b/ags-script/daily/index.xml @@ -1,7 +1,7 @@ GitHub AGS Script Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:02Z + 2024-12-10T01:28:53Z Daily Trending of AGS Script in GitHub \ No newline at end of file diff --git a/aidl/daily/index.xml b/aidl/daily/index.xml index 0ea0551d069..67684dc812c 100644 --- a/aidl/daily/index.xml +++ b/aidl/daily/index.xml @@ -1,7 +1,7 @@ GitHub AIDL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:02Z + 2024-12-10T01:28:52Z Daily Trending of AIDL in GitHub \ No newline at end of file diff --git a/al/daily/index.xml b/al/daily/index.xml index 55411a4151c..5884028e40a 100644 --- a/al/daily/index.xml +++ b/al/daily/index.xml @@ -1,7 +1,7 @@ GitHub AL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:03Z + 2024-12-10T01:28:53Z Daily Trending of AL in GitHub \ No newline at end of file diff --git a/all/daily/index.xml b/all/daily/index.xml index 4d58272220d..7e187c9fd07 100644 --- a/all/daily/index.xml +++ b/all/daily/index.xml @@ -1,28 +1,28 @@ GitHub All Languages Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:28:56Z + 2024-12-10T01:28:45Z Daily Trending of All Languages in GitHub - soxoj/maigret - 2024-12-09T01:28:56Z - tag:github.com,2024-12-09:/soxoj/maigret - - <p>🕵️‍♂️ Collect a dossier on a person by username from thousands of sites</p><hr><h1>Maigret</h1> <p align="center"> </p> <p align="center"> <a href="https://pypi.org/project/maigret/"> <img alt="PyPI version badge for Maigret" src="https://img.shields.io/pypi/v/maigret?style=flat-square"> </a> <a href="https://pypi.org/project/maigret/"> <img alt="PyPI download count for Maigret" src="https://img.shields.io/pypi/dw/maigret?style=flat-square"> </a> <a href="https://github.com/soxoj/maigret"> <img alt="Minimum Python version required: 3.10+" src="https://img.shields.io/badge/Python-3.10%2B-brightgreen?style=flat-square"> </a> <a href="https://github.com/soxoj/maigret/raw/main/LICENSE"> <img alt="License badge for Maigret" src="https://img.shields.io/github/license/soxoj/maigret?style=flat-square"> </a> <a href="https://github.com/soxoj/maigret"> <img alt="View count for Maigret project" src="https://komarev.com/ghpvc/?username=maigret&amp;color=brightgreen&amp;label=views&amp;style=flat-square"> </a> </p> <p align="center"> <img src="https://raw.githubusercontent.com/soxoj/maigret/main/static/maigret.png" height="300"> </p> <p></p> <p><i>The Commissioner Jules Maigret is a fictional French police detective, created by Georges Simenon. His investigation method is based on understanding the personality of different people and their interactions.</i></p> <p><b>👉👉👉 <a href="https://t.me/osint_maigret_bot">Online Telegram bot</a></b></p> <h2>About</h2> <p><strong>Maigret</strong> collects a dossier on a person <strong>by username only</strong>, checking for accounts on a huge number of sites and gathering all the available information from web pages. No API keys required. Maigret is an easy-to-use and powerful fork of <a href="https://github.com/sherlock-project/sherlock">Sherlock</a>.</p> <p>Currently supported more than 3000 sites (<a href="https://github.com/soxoj/maigret/raw/main/sites.md">full list</a>), search is launched against 500 popular sites in descending order of popularity by default. Also supported checking of Tor sites, I2P sites, and domains (via DNS resolving).</p> <h2>Main features</h2> <ul> <li>Profile pages parsing, <a href="https://github.com/soxoj/socid_extractor">extraction</a> of personal info, links to other profiles, etc.</li> <li>Recursive search by new usernames and other ids found</li> <li>Search by tags (site categories, countries)</li> <li>Censorship and captcha detection</li> <li>Requests retries</li> </ul> <p>See full description of Maigret features <a href="https://maigret.readthedocs.io/en/latest/features.html">in the documentation</a>.</p> <h2>Installation</h2> <p>‼️ Maigret is available online via <a href="https://t.me/osint_maigret_bot">official Telegram bot</a>. Consider using it if you don't want to install anything.</p> <h3>Windows</h3> <p>Standalone EXE-binaries for Windows are located in <a href="https://github.com/soxoj/maigret/releases">Releases section</a> of GitHub repository.</p> <p>Video guide on how to run it: <a href="https://youtu.be/qIgwTZOmMmM">https://youtu.be/qIgwTZOmMmM</a>.</p> <h3>Installation in Cloud Shells</h3> <p>You can launch Maigret using cloud shells and Jupyter notebooks. Press one of the buttons below and follow the instructions to launch it in your browser.</p> <p><a href="https://console.cloud.google.com/cloudshell/open?git_repo=https://github.com/soxoj/maigret&amp;tutorial=README.md"><img src="https://user-images.githubusercontent.com/27065646/92304704-8d146d80-ef80-11ea-8c29-0deaabb1c702.png" alt="Open in Cloud Shell"></a> <a href="https://repl.it/github/soxoj/maigret"><img src="https://replit.com/badge/github/soxoj/maigret" alt="Run on Replit" height="50"></a></p> <p><a href="https://colab.research.google.com/gist/soxoj/879b51bc3b2f8b695abb054090645000/maigret-collab.ipynb"><img src="https://colab.research.google.com/assets/colab-badge.svg?sanitize=true" alt="Open In Colab" height="45"></a> <a href="https://mybinder.org/v2/gist/soxoj/9d65c2f4d3bec5dd25949197ea73cf3a/HEAD"><img src="https://mybinder.org/badge_logo.svg?sanitize=true" alt="Open In Binder" height="45"></a></p> <h3>Local installation</h3> <p>Maigret can be installed using pip, Docker, or simply can be launched from the cloned repo.</p> <p><strong>NOTE</strong>: Python 3.10 or higher and pip is required, <strong>Python 3.11 is recommended.</strong></p> <pre><code class="language-bash"># install from pypi pip3 install maigret # usage maigret username </code></pre> <h3>Cloning a repository</h3> <pre><code class="language-bash"># or clone and install manually git clone https://github.com/soxoj/maigret &amp;&amp; cd maigret # build and install pip3 install . # usage maigret username </code></pre> <h3>Docker</h3> <pre><code class="language-bash"># official image docker pull soxoj/maigret # usage docker run -v /mydir:/app/reports soxoj/maigret:latest username --html # manual build docker build -t maigret . </code></pre> <h2>Usage examples</h2> <pre><code class="language-bash"># make HTML, PDF, and Xmind8 reports maigret user --html maigret user --pdf maigret user --xmind #Output not compatible with xmind 2022+ # search on sites marked with tags photo &amp; dating maigret user --tags photo,dating # search on sites marked with tag us maigret user --tags us # search for three usernames on all available sites maigret user1 user2 user3 -a </code></pre> <p>Use <code>maigret --help</code> to get full options description. Also options <a href="https://maigret.readthedocs.io/en/latest/command-line-options.html">are documented</a>.</p> <h2>Contributing</h2> <p>Maigret has open-source code, so you may contribute your own sites by adding them to <code>data.json</code> file, or bring changes to it's code!</p> <p>For more information about development and contribution, please read the <a href="https://maigret.readthedocs.io/en/latest/development.html">development documentation</a>.</p> <h2>Demo with page parsing and recursive username search</h2> <h3>Video (asciinema)</h3> <a href="https://asciinema.org/a/Ao0y7N0TTxpS0pisoprQJdylZ"> <img src="https://asciinema.org/a/Ao0y7N0TTxpS0pisoprQJdylZ.svg?sanitize=true" alt="asciicast" width="600"> </a> <h3>Reports</h3> <p><a href="https://raw.githubusercontent.com/soxoj/maigret/main/static/report_alexaimephotographycars.pdf">PDF report</a>, <a href="https://htmlpreview.github.io/?https://raw.githubusercontent.com/soxoj/maigret/main/static/report_alexaimephotographycars.html">HTML report</a></p> <p><img src="https://raw.githubusercontent.com/soxoj/maigret/main/static/report_alexaimephotography_html_screenshot.png" alt="HTML report screenshot"></p> <p><img src="https://raw.githubusercontent.com/soxoj/maigret/main/static/report_alexaimephotography_xmind_screenshot.png" alt="XMind 8 report screenshot"></p> <p><a href="https://raw.githubusercontent.com/soxoj/maigret/main/static/recursive_search.md">Full console output</a></p> <h2>Disclaimer</h2> <p><strong>This tool is intended for educational and lawful purposes only.</strong> The developers do not endorse or encourage any illegal activities or misuse of this tool. Regulations regarding the collection and use of personal data vary by country and region, including but not limited to GDPR in the EU, CCPA in the USA, and similar laws worldwide.</p> <p>It is your sole responsibility to ensure that your use of this tool complies with all applicable laws and regulations in your jurisdiction. Any illegal use of this tool is strictly prohibited, and you are fully accountable for your actions.</p> <p>The authors and developers of this tool bear no responsibility for any misuse or unlawful activities conducted by its users.</p> <h2>Feedback</h2> <p>If you have any questions, suggestions, or feedback, please feel free to <a href="https://github.com/soxoj/maigret/issues">open an issue</a>, create a <a href="https://github.com/soxoj/maigret/discussions">GitHub discussion</a>, or contact the author directly via <a href="https://t.me/soxoj">Telegram</a>.</p> <h2>SOWEL classification</h2> <p>This tool uses the following OSINT techniques:</p> <ul> <li><a href="https://sowel.soxoj.com/other-platform-accounts">SOTL-2.2. Search For Accounts On Other Platforms</a></li> <li><a href="https://sowel.soxoj.com/logins-reuse">SOTL-6.1. Check Logins Reuse To Find Another Account</a></li> <li><a href="https://sowel.soxoj.com/nicknames-reuse">SOTL-6.2. Check Nicknames Reuse To Find Another Account</a></li> </ul> <h2>License</h2> <p>MIT © <a href="https://github.com/soxoj/maigret">Maigret</a><br> MIT © <a href="https://github.com/sherlock-project/">Sherlock Project</a><br> Original Creator of Sherlock Project - <a href="https://github.com/sdushantha">Siddharth Dushantha</a></p> + nexus-xyz/nexus-zkvm + 2024-12-10T01:28:45Z + tag:github.com,2024-12-10:/nexus-xyz/nexus-zkvm + + <p>The Nexus zkVM: The zero-knowledge virtual machine</p><hr><h1>The Nexus zkVM</h1> <div align="left"> <a href="https://t.me/nexus_zkvm"> <img src="https://img.shields.io/endpoint?color=neon&amp;logo=telegram&amp;label=chat&amp;url=https%3A%2F%2Fmogyo.ro%2Fquart-apis%2Ftgmembercount%3Fchat_id%3Dnexus_zkvm"></a> <a href="https://github.com/nexus-xyz/nexus-zkvm/graphs/contributors"> <img src="https://img.shields.io/github/contributors/nexus-xyz/nexus-zkvm.svg?sanitize=true"></a> <a href="https://twitter.com/NexusLabsHQ"> <img src="https://img.shields.io/badge/Twitter-black?logo=x&amp;logoColor=white"></a> <a href="https://nexus.xyz"> <img src="https://img.shields.io/static/v1?label=Stage&amp;message=Alpha&amp;color=2BB4AB"></a> <a href="https://github.com/nexus-xyz/nexus-zkvm/raw/main/LICENSE-MIT"> <img src="https://img.shields.io/badge/license-MIT-blue"></a> <a href="https://github.com/nexus-xyz/nexus-zkvm/raw/main/LICENSE-APACHE"> <img src="https://img.shields.io/badge/license-APACHE-blue"></a> </div> <p align="center"> </p> <p align="center"> <img width="100%" src="https://raw.githubusercontent.com/nexus-xyz/nexus-zkvm/main/assets/nexus_docs-header.png" alt="Logo"> </p> <p></p> <p>The Nexus zkVM is a modular, extensible, open-source, and highly-parallelized zkVM, designed to run at <em>a trillion CPU cycles proved per second</em> given enough machine power.</p> <h2>Folding schemes</h2> <p>If you're interested in our implementation of folding schemes, check the <a href="https://raw.githubusercontent.com/nexus-xyz/nexus-zkvm/main/nova/"><code>nexus-nova</code></a> crate.</p> <h2>Quick Start</h2> <h3>1. Install the Nexus zkVM</h3> <p>First, install Rust: <a href="https://www.rust-lang.org/tools/install">https://www.rust-lang.org/tools/install</a>.</p> <p>Also, make sure you have a working version of <a href="https://cmake.org/">cmake</a>.</p> <p>Next, install the RISC-V target:</p> <pre><code class="language-shell">rustup target add riscv32i-unknown-none-elf </code></pre> <p>Then, install the Nexus zkVM:</p> <pre><code class="language-shell">cargo install --git https://github.com/nexus-xyz/nexus-zkvm cargo-nexus --tag 'v0.2.4' </code></pre> <p>Verify the installation:</p> <pre><code class="language-shell">cargo nexus --help </code></pre> <p>This should print the available CLI commands.</p> <h3>2. Create a new Nexus project</h3> <pre><code class="language-shell">cargo nexus new nexus-project </code></pre> <p>This will create a new Rust project directory with the following structure:</p> <pre><code class="language-shell">./nexus-project ├── Cargo.lock ├── Cargo.toml └── src └── main.rs </code></pre> <p>As an example, you can change the content of <code>./src/main.rs</code> to:</p> <pre><code class="language-rust">#![cfg_attr(target_arch = "riscv32", no_std, no_main)] fn fib(n: u32) -&gt; u32 { match n { 0 =&gt; 0, 1 =&gt; 1, _ =&gt; fib(n - 1) + fib(n - 2), } } #[nexus_rt::main] fn main() { let n = 7; let result = fib(n); assert_eq!(result, 13); } </code></pre> <h3>3. Run your program</h3> <pre><code class="language-bash">cargo nexus run </code></pre> <p>This command should run successfully. To print the full step-by-step execution trace on the NVM, run:</p> <pre><code class="language-bash">cargo nexus run -v </code></pre> <h3>4. Prove your program</h3> <p>Generate a proof for your Rust program using the Nexus zkVM.</p> <pre><code class="language-shell">cargo nexus prove </code></pre> <p>This command will save the proof to <code>./nexus-proof</code>.</p> <h3>5. Verify your proof</h3> <p>Finally, load and verify the proof:</p> <pre><code class="language-shell">cargo nexus verify </code></pre> <h2>Learn More</h2> <p>Run <code>cargo nexus --help</code> to see all the available commands.</p> <p>Also check out the documentation at <a href="https://docs.nexus.xyz">docs.nexus.xyz</a>, or join our <a href="https://t.me/nexus_zkvm">Telegram</a> chat to discuss!</p> <p>Nexus is committed to open-source. All of our code is dual licensed under MIT and Apache licenses. We encourage and appreciate contributions.</p> - skills/copilot-codespaces-vscode - 2024-12-09T01:28:56Z - tag:github.com,2024-12-09:/skills/copilot-codespaces-vscode - - <p>Develop with AI-powered code suggestions using GitHub Copilot and VS Code</p><hr><header> <!-- <<< Author notes: Course header >>> Read <https://skills.github.com/quickstart> for more information about how to build courses using this template. Include a 1280×640 image, course name in sentence case, and a concise description in emphasis. In your repository settings: enable template repository, add your 1280×640 social image, auto delete head branches. Next to "About", add description & tags; disable releases, packages, & environments. Add your open source license, GitHub uses the MIT license. --> <h1>Code with GitHub Copilot</h1> <p><em>GitHub Copilot can help you code by offering autocomplete-style suggestions right in VS Code and Codespaces.</em></p> </header> <!-- <<< Author notes: Course start >>> Include start button, a note about Actions minutes, and tell the learner why they should take the course. --> <h2>Welcome</h2> <p>GitHub Copilot can help you code by offering autocomplete-style suggestions. You can learn how GitHub Copilot works, and what to consider while using GitHub Copilot. GitHub Copilot analyzes the context in the file you are editing, as well as related files, and offers suggestions from within your text editor. GitHub Copilot is powered by OpenAI Codex, a new AI system created by OpenAI.</p> <ul> <li><strong>Who this is for</strong>: Developers, DevOps Engineers, Software development managers, Testers.</li> <li><strong>What you'll learn</strong>: How to install Copilot into a Codespace, accept suggestions from code, accept suggestions from comments.</li> <li><strong>What you'll build</strong>: Javascript files that will have code generated by Copilot AI for code and comment suggestions.</li> <li><strong>Prerequisites</strong>: To use GitHub Copilot you must have an active GitHub Copilot subscription. Sign up for 30 days free <a href="https://github.com/settings/copilot">Copilot</a>.</li> <li><strong>Timing</strong>: This course can be completed in under an hour.</li> </ul> <h3>How to start this course</h3> <!-- For start course, run in JavaScript: 'https://github.com/new?' + new URLSearchParams({ template_owner: 'skills', template_name: 'copilot-codespaces-vscode', owner: '@me', name: 'skills-copilot-codespaces-vscode', description: 'My clone repository', visibility: 'public', }).toString() --> <p><a href="https://github.com/new?template_owner=skills&amp;template_name=copilot-codespaces-vscode&amp;owner=%40me&amp;name=skills-copilot-codespaces-vscode&amp;description=My+clone+repository&amp;visibility=public"><img src="https://user-images.githubusercontent.com/1221423/235727646-4a590299-ffe5-480d-8cd5-8194ea184546.svg?sanitize=true" alt="start-course"></a></p> <ol> <li>Right-click <strong>Start course</strong> and open the link in a new tab.</li> <li>In the new tab, most of the prompts will automatically fill in for you. <ul> <li>For owner, choose your personal account or an organization to host the repository.</li> <li>We recommend creating a public repository, as private repositories will <a href="https://docs.github.com/en/billing/managing-billing-for-github-actions/about-billing-for-github-actions">use Actions minutes</a>.</li> <li>Scroll down and click the <strong>Create repository</strong> button at the bottom of the form.</li> </ul> </li> <li>After your new repository is created, wait about 20 seconds, then refresh the page. Follow the step-by-step instructions in the new repository's README.</li> </ol> <footer> <!-- <<< Author notes: Footer >>> Add a link to get support, GitHub status page, code of conduct, license link. --> <hr> <p>Get help: <a href="https://github.com/orgs/skills/discussions/categories/code-with-copilot">Post in our discussion board</a> • <a href="https://www.githubstatus.com/">Review the GitHub status page</a></p> <p>© 2023 GitHub • <a href="https://www.contributor-covenant.org/version/2/1/code_of_conduct/code_of_conduct.md">Code of Conduct</a> • <a href="https://gh.io/mit">MIT License</a></p> </footer> + meta-llama/llama-models + 2024-12-10T01:28:45Z + tag:github.com,2024-12-10:/meta-llama/llama-models + + <p>Utilities intended for use with Llama models.</p><hr><p align="center"> <img src="https://raw.githubusercontent.com/meta-llama/llama-models/main/Llama_Repo.jpeg" width="400"> </p> <p align="center"> 🤗 <a href="https://huggingface.co/meta-Llama"> Models on Hugging Face</a>&nbsp; | <a href="https://ai.meta.com/blog/"> Blog</a>&nbsp; | <a href="https://llama.meta.com/">Website</a>&nbsp; | <a href="https://llama.meta.com/get-started/">Get Started</a>&nbsp; <br> </p> <hr> <h1>Llama Models</h1> <p>Llama is an accessible, open large language model (LLM) designed for developers, researchers, and businesses to build, experiment, and responsibly scale their generative AI ideas. Part of a foundational system, it serves as a bedrock for innovation in the global community. A few key aspects:</p> <ol> <li><strong>Open access</strong>: Easy accessibility to cutting-edge large language models, fostering collaboration and advancements among developers, researchers, and organizations</li> <li><strong>Broad ecosystem</strong>: Llama models have been downloaded hundreds of millions of times, there are thousands of community projects built on Llama and platform support is broad from cloud providers to startups - the world is building with Llama!</li> <li><strong>Trust &amp; safety</strong>: Llama models are part of a comprehensive approach to trust and safety, releasing models and tools that are designed to enable community collaboration and encourage the standardization of the development and usage of trust and safety tools for generative AI</li> </ol> <p>Our mission is to empower individuals and industry through this opportunity while fostering an environment of discovery and ethical AI advancements. The model weights are licensed for researchers and commercial entities, upholding the principles of openness.</p> <h2>Llama Models</h2> <p><a href="https://pypi.org/project/llama-models/"><img src="https://img.shields.io/pypi/dm/llama-models" alt="PyPI - Downloads"></a> <a href="https://discord.gg/TZAAYNVtrU"><img src="https://img.shields.io/discord/1257833999603335178" alt="Discord"></a></p> <table> <thead> <tr> <th align="center"><strong>Model</strong></th> <th align="center"><strong>Launch date</strong></th> <th align="center"><strong>Model sizes</strong></th> <th align="center"><strong>Context Length</strong></th> <th align="center"><strong>Tokenizer</strong></th> <th align="center"><strong>Acceptable use policy</strong></th> <th align="center"><strong>License</strong></th> <th align="center"><strong>Model Card</strong></th> </tr> </thead> <tbody> <tr> <td align="center">Llama 2</td> <td align="center">7/18/2023</td> <td align="center">7B, 13B, 70B</td> <td align="center">4K</td> <td align="center">Sentencepiece</td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama2/USE_POLICY.md">Use Policy</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama2/LICENSE">License</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama2/MODEL_CARD.md">Model Card</a></td> </tr> <tr> <td align="center">Llama 3</td> <td align="center">4/18/2024</td> <td align="center">8B, 70B</td> <td align="center">8K</td> <td align="center">TikToken-based</td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3/USE_POLICY.md">Use Policy</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3/LICENSE">License</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3/MODEL_CARD.md">Model Card</a></td> </tr> <tr> <td align="center">Llama 3.1</td> <td align="center">7/23/2024</td> <td align="center">8B, 70B, 405B</td> <td align="center">128K</td> <td align="center">TikToken-based</td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_1/USE_POLICY.md">Use Policy</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_1/LICENSE">License</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_1/MODEL_CARD.md">Model Card</a></td> </tr> <tr> <td align="center">Llama 3.2</td> <td align="center">9/25/2024</td> <td align="center">1B, 3B</td> <td align="center">128K</td> <td align="center">TikToken-based</td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_2/USE_POLICY.md">Use Policy</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_2/LICENSE">License</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_2/MODEL_CARD.md">Model Card</a></td> </tr> <tr> <td align="center">Llama 3.2-Vision</td> <td align="center">9/25/2024</td> <td align="center">11B, 90B</td> <td align="center">128K</td> <td align="center">TikToken-based</td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_2/USE_POLICY.md">Use Policy</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_2/LICENSE">License</a></td> <td align="center"><a href="https://raw.githubusercontent.com/meta-llama/llama-models/main/models/llama3_2/MODEL_CARD_VISION.md">Model Card</a></td> </tr> </tbody> </table> <h2>Download</h2> <p>To download the model weights and tokenizer:</p> <ol> <li> <p>Visit the <a href="https://llama.meta.com/llama-downloads/">Meta Llama website</a>.</p> </li> <li> <p>Read and accept the license.</p> </li> <li> <p>Once your request is approved you will receive a signed URL via email.</p> </li> <li> <p>Install the <a href="https://github.com/meta-llama/llama-stack">Llama CLI</a>: <code>pip install llama-stack</code>. (<strong>&lt;-- Start Here if you have received an email already.</strong>)</p> </li> <li> <p>Run <code>llama model list</code> to show the latest available models and determine the model ID you wish to download. <strong>NOTE</strong>: If you want older versions of models, run <code>llama model list --show-all</code> to show all the available Llama models.</p> </li> <li> <p>Run: <code>llama download --source meta --model-id CHOSEN_MODEL_ID</code></p> </li> <li> <p>Pass the URL provided when prompted to start the download.</p> </li> </ol> <p>Remember that the links expire after 24 hours and a certain amount of downloads. You can always re-request a link if you start seeing errors such as <code>403: Forbidden</code>.</p> <h2>Running the models</h2> <p>You need to install the following dependencies (in addition to the <code>requirements.txt</code> in the root directory of this repository) to run the models:</p> <pre><code>pip install torch fairscale fire blobfile </code></pre> <p>After installing the dependencies, you can run the example scripts (within <code>llama_models/scripts/</code> sub-directory) as follows:</p> <pre><code class="language-bash">#!/bin/bash CHECKPOINT_DIR=~/.llama/checkpoints/Meta-Llama3.1-8B-Instruct PYTHONPATH=$(git rev-parse --show-toplevel) torchrun llama_models/scripts/example_chat_completion.py $CHECKPOINT_DIR </code></pre> <p>The above script should be used with an Instruct (Chat) model. For a Base model, use the script <code>llama_models/scripts/example_text_completion.py</code>. Note that you can use these scripts with both Llama3 and Llama3.1 series of models.</p> <p>For running larger models with tensor parallelism, you should modify as:</p> <pre><code class="language-bash">#!/bin/bash NGPUS=8 PYTHONPATH=$(git rev-parse --show-toplevel) torchrun \ --nproc_per_node=$NGPUS \ llama_models/scripts/example_chat_completion.py $CHECKPOINT_DIR \ --model_parallel_size $NGPUS </code></pre> <p>For more flexibility in running inference (including running FP8 inference), please see the <a href="https://github.com/meta-llama/llama-stack"><code>Llama Stack</code></a> repository.</p> <h2>Access to Hugging Face</h2> <p>We also provide downloads on <a href="https://huggingface.co/meta-llama">Hugging Face</a>, in both transformers and native <code>llama3</code> formats. To download the weights from Hugging Face, please follow these steps:</p> <ul> <li>Visit one of the repos, for example <a href="https://huggingface.co/meta-llama/Meta-Llama-3.1-8B-Instruct">meta-llama/Meta-Llama-3.1-8B-Instruct</a>.</li> <li>Read and accept the license. Once your request is approved, you'll be granted access to all Llama 3.1 models as well as previous versions. Note that requests used to take up to one hour to get processed.</li> <li>To download the original native weights to use with this repo, click on the "Files and versions" tab and download the contents of the <code>original</code> folder. You can also download them from the command line if you <code>pip install huggingface-hub</code>:</li> </ul> <pre><code class="language-bash">huggingface-cli download meta-llama/Meta-Llama-3.1-8B-Instruct --include "original/*" --local-dir meta-llama/Meta-Llama-3.1-8B-Instruct </code></pre> <p><strong>NOTE</strong> The original native weights of meta-llama/Meta-Llama-3.1-405B would not be available through this HugginFace repo.</p> <ul> <li> <p>To use with transformers, the following <a href="https://huggingface.co/docs/transformers/en/main_classes/pipelines">pipeline</a> snippet will download and cache the weights:</p> <pre><code class="language-python">import transformers import torch model_id = "meta-llama/Meta-Llama-3.1-8B-Instruct" pipeline = transformers.pipeline( "text-generation", model="meta-llama/Meta-Llama-3.1-8B-Instruct", model_kwargs={"torch_dtype": torch.bfloat16}, device="cuda", ) </code></pre> </li> </ul> <h2>Installations</h2> <p>You can install this repository as a <a href="https://pypi.org/project/llama-models/">package</a> by just doing <code>pip install llama-models</code></p> <h2>Responsible Use</h2> <p>Llama models are a new technology that carries potential risks with use. Testing conducted to date has not — and could not — cover all scenarios. To help developers address these risks, we have created the <a href="https://ai.meta.com/static-resource/responsible-use-guide/">Responsible Use Guide</a>.</p> <h2>Issues</h2> <p>Please report any software “bug” or other problems with the models through one of the following means:</p> <ul> <li>Reporting issues with the model: <a href="https://github.com/meta-llama/llama-models/issues">https://github.com/meta-llama/llama-models/issues</a></li> <li>Reporting risky content generated by the model: <a href="http://developers.facebook.com/llama_output_feedback">developers.facebook.com/llama_output_feedback</a></li> <li>Reporting bugs and security concerns: <a href="http://facebook.com/whitehat/info">facebook.com/whitehat/info</a></li> </ul> <h2>Questions</h2> <p>For common questions, the FAQ can be found <a href="https://llama.meta.com/faq">here</a>, which will be updated over time as new questions arise.</p> - evolutionaryscale/esm - 2024-12-09T01:28:56Z - tag:github.com,2024-12-09:/evolutionaryscale/esm - - <p></p><hr><ul> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#installation-">Installation </a></li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#esm-c-">ESM C </a> <ul> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#using-esm-c-300m-and-600m-via-github">Using ESM C 300M and 600M via GitHub</a></li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#using-esm-c-6b-via-forge-api">Using ESM C 6B via Forge API</a></li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#using-esm-c-6b-via-sagemaker">Using ESM C 6B via SageMaker</a></li> </ul> </li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#esm-3--">ESM 3 </a> <ul> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#quickstart-for-esm3-open">Quickstart for ESM3-open</a></li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#forge-access-to-larger-esm3-models">Forge: Access to larger ESM3 models</a></li> </ul> </li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#responsible-development-">Responsible Development </a></li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#licenses--">Licenses </a></li> </ul> <h2>Installation <a name="installation"></a></h2> <p>To get started with ESM, install the library using pip:</p> <pre><code class="language-bash">pip install esm </code></pre> <h2>ESM C <a name="esm-c"></a></h2> <p><a href="https://www.evolutionaryscale.ai/blog/esm-cambrian">ESM Cambrian</a> is a parallel model family to our flagship ESM3 generative models. While ESM3 focuses on controllable generation of proteins for therapeutic and many other applications, ESM C focuses on creating representations of the underlying biology of proteins.</p> <p>ESM C comes with major performance benefits over ESM2. The 300M parameter ESM C delivers similar performance to ESM2 650M with dramatically reduced memory requirements and faster inference. The 600M parameter ESM C rivals the 3B parameter ESM2 and approaches the capabilities of the 15B model, delivering frontier performance with far greater efficiency. The 6B parameter ESM C sets a new benchmark, outperforming the best ESM2 models by a wide margin.</p> <p>ESM C models are available immediately for academic and commercial use under a new license structure designed to promote openness and enable scientists and builders. You can find the high level take-away of the license structure in the <a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/#licenses">Licenses</a> section of this page, and the full license structure in the <a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/LICENSE.md">LICENSE.md</a> file.</p> <p>You can use the following guides to start using ESM C models today, either <a href="https://huggingface.co/EvolutionaryScale">running the model locally</a>, <a href="https://forge.evolutionaryscale.ai/">the Forge API</a> and <a href="https://aws.amazon.com/marketplace/seller-profile?id=seller-iw2nbscescndm">AWS SageMaker</a>.</p> <h3>Using ESM C 300M and 600M via GitHub</h3> <p>ESM C model weights are stored on the HuggingFace hub under <a href="https://huggingface.co/EvolutionaryScale/">https://huggingface.co/EvolutionaryScale/</a>.</p> <pre><code class="language-py">from esm.models.esmc import ESMC from esm.sdk.api import ESMProtein, LogitsConfig protein = ESMProtein(sequence="AAAAA") client = ESMC.from_pretrained("esmc_300m").to("cuda") # or "cpu" protein_tensor = client.encode(protein) logits_output = client.logits( protein_tensor, LogitsConfig(sequence=True, return_embeddings=True) ) print(logits_output.logits, logits_output.embeddings) </code></pre> <h3>Using ESM C 6B via Forge API</h3> <p>ESM C models, including ESMC 6B, are accessible via EvolutionaryScale Forge. You can request access and utilize these models through forge.evolutionaryscale.ai, as demonstrated in the example below.</p> <pre><code class="language-py">from esm.sdk.forge import ESM3ForgeInferenceClient from esm.sdk.api import ESMProtein, LogitsConfig # Apply for forge access and get an access token forge_client = ESM3ForgeInferenceClient(model="esmc-6b-2024-12", url="https://forge.evolutionaryscale.ai", token="&lt;your forge token&gt;") protein_tensor = forge_client.encode(protein) logits_output = forge_client.logits( protein_tensor, LogitsConfig(sequence=True, return_embeddings=True) ) print(logits_output.logits, logits_output.embeddings) </code></pre> <h3>Using ESM C 6B via SageMaker</h3> <p>ESM C models are also available on Amazon SageMaker. They function similarly to the ESM3 model family, and you can refer to the sample notebooks provided in this repository for examples.</p> <p>You'll need an admin AWS access to an AWS account to follow these instructions. To deploy, first we need to deploy the AWS package:</p> <ol> <li>Find the ESM C model version you want to subscribe to. All of our offerings are visible <a href="https://aws.amazon.com/marketplace/seller-profile?id=seller-iw2nbscescndm">here</a>.</li> <li>Click the name of the model version you are interested in, review pricing information and the end user license agreement (EULA), then click "Continue to Subscribe".</li> <li>Once you have subscribed, you should be able to see our model under your <a href="https://us-east-1.console.aws.amazon.com/marketplace/home#/subscriptions">marketplace subscriptions</a>.</li> <li>Click the product name and then from the "Actions" dropdown select "Configure".</li> <li>You will next see the "Configure and Launch" UI. There are multiple deployment paths - we recommend using "AWS CloudFormation".</li> <li>The default value for "Service Access" may or may not work. We recommend clicking "Create and use a new service role".</li> <li>Click "Launch CloudFormation Template". This takes 15 to 25 minutes depending on model size.</li> <li>On the "Quick create stack" page, ensure the stack name and endpoint names are not already used. You can check existing stack names <a href="https://console.aws.amazon.com/cloudformation/home/stacks">here</a> and existing endpoint names <a href="https://us-east-1.console.aws.amazon.com/sagemaker/home?region=us-east-1#/endpoints">here</a>.</li> </ol> <p>The Sagemaker deployment of the model now lives on a dedicated GPU instance inside your AWS environment, and will be billed directly to your AWS account. Make sure to remember to shut down the instance after you stop using it. Find the CloudFormation stack you created <a href="https://us-east-1.console.aws.amazon.com/cloudformation/home">here</a>, select it, and then click "Delete" to clean up all resources.</p> <p>After creating the endpoint, you can create a sagemaker client and use it the same way as a forge client. They share the same API.</p> <p>Ensure that the code below runs in an environment that has AWS credentials available for the account which provisioned SageMaker resources. Learn more about general AWS credential options <a href="https://docs.aws.amazon.com/cli/latest/userguide/cli-chap-authentication.html#cli-chap-authentication-precedence">here</a>.</p> <pre><code class="language-py">from esm.sdk.sagemaker import ESM3SageMakerClient from esm.sdk.api import ESMProtein, LogitsConfig sagemaker_client = ESM3SageMakerClient( # E.g. "Endpoint-ESMC-6B-1" endpoint_name=SAGE_ENDPOINT_NAME, # E.g. "esmc-6b-2024-12". Same model names as in Forge. model=MODEL_NAME, ) protein = ESMProtein(sequence="AAAAA") protein_tensor = sagemaker_client.encode(protein) logits_output = sagemaker_client.logits( protein_tensor, LogitsConfig(sequence=True, return_embeddings=True) ) print(logits_output.logits, logits_output.embeddings) </code></pre> <h2>ESM 3 <a name="esm3"></a></h2> <p><a href="https://www.evolutionaryscale.ai/papers/esm3-simulating-500-million-years-of-evolution-with-a-language-model">ESM3</a> is a frontier generative model for biology, able to jointly reason across three fundamental biological properties of proteins: sequence, structure, and function. These three data modalities are represented as tracks of discrete tokens at the input and output of ESM3. You can present the model with a combination of partial inputs across the tracks, and ESM3 will provide output predictions for all the tracks.</p> <p>ESM3 is a <em>generative</em> masked language model. You can prompt it with partial sequence, structure, and function keywords, and iteratively sample masked positions until all positions are unmasked. This iterative sampling is what the <code>.generate()</code> function does.</p> <!--![ESM3 Diagram](_assets/esm3_diagram.png)--> <img src="https://raw.githubusercontent.com/evolutionaryscale/esm/main/_assets/esm3_diagram.png" alt="ESM3 Diagram" width="400"> <p>The ESM3 architecture is highly scalable due to its transformer backbone and all-to-all reasoning over discrete token sequences. At its largest scale, ESM3 was trained with 1.07e24 FLOPs on 2.78 billion proteins and 771 billion unique tokens, and has 98 billion parameters. Learn more by reading the <a href="https://www.evolutionaryscale.ai/blog/esm3-release">blog post</a> and <a href="https://www.evolutionaryscale.ai/papers/esm3-simulating-500-million-years-of-evolution-with-a-language-model">the pre-print (Hayes et al., 2024)</a>.</p> <p>Here we present <code>esm3-open-small</code>. With 1.4B parameters it is the smallest and fastest model in the family. ESM3-open is available under the <a href="https://www.evolutionaryscale.ai/policies/cambrian-non-commercial-license-agreement">Cambrian non-commercial license agreement</a>, as outlined in <code>LICENSE.md</code> (note: updated with ESM C release). Visit our <a href="https://github.com/evolutionaryscale/esm/discussions">Discussions page</a> to get in touch, provide feedback, ask questions or share your experience with ESM3!</p> <h3>Quickstart for ESM3-open</h3> <pre><code>pip install esm </code></pre> <p>In order to download the weights, we require users to accept our non-commercial license. The weights are stored on HuggingFace Hub under <a href="https://huggingface.co/EvolutionaryScale/esm3">HuggingFace/EvolutionaryScale/esm3</a>. Please create an account and accept the license.</p> <pre><code class="language-py">from huggingface_hub import login from esm.models.esm3 import ESM3 from esm.sdk.api import ESM3InferenceClient, ESMProtein, GenerationConfig # Will instruct you how to get an API key from huggingface hub, make one with "Read" permission. login() # This will download the model weights and instantiate the model on your machine. model: ESM3InferenceClient = ESM3.from_pretrained("esm3-open").to("cuda") # or "cpu" # Generate a completion for a partial Carbonic Anhydrase (2vvb) prompt = "___________________________________________________DQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPP___________________________________________________________" protein = ESMProtein(sequence=prompt) # Generate the sequence, then the structure. This will iteratively unmask the sequence track. protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8, temperature=0.7)) # We can show the predicted structure for the generated sequence. protein = model.generate(protein, GenerationConfig(track="structure", num_steps=8)) protein.to_pdb("./generation.pdb") # Then we can do a round trip design by inverse folding the sequence and recomputing the structure protein.sequence = None protein = model.generate(protein, GenerationConfig(track="sequence", num_steps=8)) protein.coordinates = None protein = model.generate(protein, GenerationConfig(track="structure", num_steps=8)) protein.to_pdb("./round_tripped.pdb") </code></pre> <p>Congratulations, you just generated your first proteins with ESM3! Let's explore some more advanced prompting with the help of our <a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/examples/">notebooks and scripts</a>.</p> <p><code>generate.ipynb</code> will walk through two prompting examples (scaffolding and secondary structure editing) using the open model: <a href="https://colab.research.google.com/github/evolutionaryscale/esm/blob/main/examples/generate.ipynb"><img src="https://colab.research.google.com/assets/colab-badge.svg?sanitize=true"></a></p> <p><code>gfp_design.ipynb</code> will walk through the more complex generation procedure we used to design esmGFP: <a href="https://colab.research.google.com/github/evolutionaryscale/esm/blob/main/examples/gfp_design.ipynb"><img src="https://colab.research.google.com/assets/colab-badge.svg?sanitize=true"></a></p> <p>We also provide example scripts that show common workflows under <code>examples/</code>:</p> <ul> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/examples/local_generate.py">local_generate.py</a> shows how simple and elegant common tasks are: it shows folding, inverse folding and chain of thought generation, all by calling just <code>model.generate()</code> for iterative decoding.</li> <li><a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/examples/seqfun_struct.py">seqfun_struct.py</a> shows direct use of the model as a standard pytorch model with a simple model <code>forward</code> call.</li> </ul> <h3>Forge: Access to larger ESM3 models</h3> <p>You can apply for beta access to the full family of larger and higher capability ESM3 models at <a href="https://forge.evolutionaryscale.ai">EvolutionaryScale Forge</a>.</p> <p>We encourage users to interact with the Forge API through the python <code>esm</code> library instead of the command line. The python interface enables you to interactively load proteins, build prompts, and inspect generated proteins with the <code>ESMProtein</code> and config classes used to interact with the local model.</p> <p>In any example script try to replace a local <code>ESM3</code> model with a Forge API client:</p> <pre><code class="language-py"># Instead of loading the model locally on your machine: model: ESM3InferenceClient = ESM3.from_pretrained("esm3_sm_open_v1").to("cuda") # or "cpu" # just replace the line with this: model: ESM3InferenceClient = esm.sdk.client("esm3-medium-2024-08", token="&lt;your forge token&gt;") # and now you're interfacing with the model running on our remote servers. ... </code></pre> <p>and the exact same code will work. This enables a seamless transition from smaller and faster models, to our large 98B protein language models for protein design work.</p> <h2>Responsible Development <a name="responsible-development"></a></h2> <p>EvolutionaryScale is a public benefit company. Our mission is to develop artificial intelligence to understand biology for the benefit of human health and society, through partnership with the scientific community, and open, safe, and responsible research. Inspired by the history of our field as well as <a href="https://responsiblebiodesign.ai/">new principles and recommendations</a>, we have created a Responsible Development Framework to guide our work towards our mission with transparency and clarity.</p> <p>The core tenets of our framework are</p> <ul> <li>We will communicate the benefits and risks of our research</li> <li>We will proactively and rigorously evaluate the risk of our models before public deployment</li> <li>We will adopt risk mitigation strategies and precautionary guardrails</li> <li>We will work with stakeholders in government, policy, and civil society to keep them informed</li> </ul> <p>With this in mind, we have performed a variety of mitigations for <code>esm3-sm-open-v1</code>, detailed in our <a href="https://www.evolutionaryscale.ai/papers/esm3-simulating-500-million-years-of-evolution-with-a-language-model">paper</a></p> <h2>Licenses <a name="licenses"></a></h2> <p>The code and model weights of ESM3 and ESM C are available under a mixture of non-commercial and more permissive licenses, fully outlined in <a href="https://raw.githubusercontent.com/evolutionaryscale/esm/main/LICENSE.md">LICENSE.md</a>.</p> + microsoft/torchgeo + 2024-12-10T01:28:45Z + tag:github.com,2024-12-10:/microsoft/torchgeo + + <p>TorchGeo: datasets, samplers, transforms, and pre-trained models for geospatial data</p><hr><img src="https://raw.githubusercontent.com/microsoft/torchgeo/main/logo/logo-color.svg?sanitize=true" width="400" alt="TorchGeo logo"> <p>TorchGeo is a <a href="https://pytorch.org/">PyTorch</a> domain library, similar to <a href="https://pytorch.org/vision">torchvision</a>, providing datasets, samplers, transforms, and pre-trained models specific to geospatial data.</p> <p>The goal of this library is to make it simple:</p> <ol> <li>for machine learning experts to work with geospatial data, and</li> <li>for remote sensing experts to explore machine learning solutions.</li> </ol> <p>Community: <a href="https://join.slack.com/t/torchgeo/shared_invite/zt-22rse667m-eqtCeNW0yI000Tl4B~2PIw"><img src="https://img.shields.io/badge/Slack-join-4A154B?logo=slack" alt="slack"></a> <a href="https://www.osgeo.org/community/getting-started-osgeo/"><img src="https://img.shields.io/badge/OSGeo-join-4CB05B?logo=osgeo" alt="osgeo"></a> <a href="https://huggingface.co/torchgeo"><img src="https://img.shields.io/badge/Hugging_Face-join-FFD21E?logo=huggingface" alt="huggingface"></a> <a href="https://pytorch.org/ecosystem/join"><img src="https://img.shields.io/badge/PyTorch-join-DE3412?logo=pytorch" alt="pytorch"></a></p> <p>Packaging: <a href="https://pypi.org/project/torchgeo/"><img src="https://badge.fury.io/py/torchgeo.svg?sanitize=true" alt="pypi"></a> <a href="https://anaconda.org/conda-forge/torchgeo"><img src="https://anaconda.org/conda-forge/torchgeo/badges/version.svg?sanitize=true" alt="conda"></a> <a href="https://packages.spack.io/package.html?name=py-torchgeo"><img src="https://img.shields.io/spack/v/py-torchgeo" alt="spack"></a></p> <p>Testing: <a href="https://torchgeo.readthedocs.io/en/stable/"><img src="https://readthedocs.org/projects/torchgeo/badge/?version=latest" alt="docs"></a> <a href="https://github.com/microsoft/torchgeo/actions/workflows/style.yaml"><img src="https://github.com/microsoft/torchgeo/actions/workflows/style.yaml/badge.svg?sanitize=true" alt="style"></a> <a href="https://github.com/microsoft/torchgeo/actions/workflows/tests.yaml"><img src="https://github.com/microsoft/torchgeo/actions/workflows/tests.yaml/badge.svg?sanitize=true" alt="tests"></a> <a href="https://codecov.io/gh/microsoft/torchgeo"><img src="https://codecov.io/gh/microsoft/torchgeo/branch/main/graph/badge.svg?token=oa3Z3PMVOg" alt="codecov"></a></p> <h2>Installation</h2> <p>The recommended way to install TorchGeo is with <a href="https://pip.pypa.io/">pip</a>:</p> <pre><code class="language-console">$ pip install torchgeo </code></pre> <p>For <a href="https://docs.conda.io/">conda</a> and <a href="https://spack.io/">spack</a> installation instructions, see the <a href="https://torchgeo.readthedocs.io/en/stable/user/installation.html">documentation</a>.</p> <h2>Documentation</h2> <p>You can find the documentation for TorchGeo on <a href="https://torchgeo.readthedocs.io">ReadTheDocs</a>. This includes API documentation, contributing instructions, and several <a href="https://torchgeo.readthedocs.io/en/stable/tutorials/getting_started.html">tutorials</a>. For more details, check out our <a href="https://arxiv.org/abs/2111.08872">paper</a>, <a href="https://www.youtube.com/watch?v=ET8Hb_HqNJQ">podcast episode</a>, <a href="https://www.youtube.com/watch?v=R_FhY8aq708">tutorial</a>, and <a href="https://pytorch.org/blog/geospatial-deep-learning-with-torchgeo/">blog post</a>.</p> <p float="left"> <a href="https://www.youtube.com/watch?v=ET8Hb_HqNJQ"> <img src="https://img.youtube.com/vi/ET8Hb_HqNJQ/0.jpg" style="width:49%;"> </a> <a href="https://www.youtube.com/watch?v=R_FhY8aq708"> <img src="https://img.youtube.com/vi/R_FhY8aq708/0.jpg" style="width:49%;"> </a> </p> <h2>Example Usage</h2> <p>The following sections give basic examples of what you can do with TorchGeo.</p> <p>First we'll import various classes and functions used in the following sections:</p> <pre><code class="language-python">from lightning.pytorch import Trainer from torch.utils.data import DataLoader from torchgeo.datamodules import InriaAerialImageLabelingDataModule from torchgeo.datasets import CDL, Landsat7, Landsat8, VHR10, stack_samples from torchgeo.samplers import RandomGeoSampler from torchgeo.trainers import SemanticSegmentationTask </code></pre> <h3>Geospatial datasets and samplers</h3> <p>Many remote sensing applications involve working with <a href="https://torchgeo.readthedocs.io/en/stable/api/datasets.html#geospatial-datasets"><em>geospatial datasets</em></a>—datasets with geographic metadata. These datasets can be challenging to work with due to the sheer variety of data. Geospatial imagery is often multispectral with a different number of spectral bands and spatial resolution for every satellite. In addition, each file may be in a different coordinate reference system (CRS), requiring the data to be reprojected into a matching CRS.</p> <img src="https://raw.githubusercontent.com/microsoft/torchgeo/main/images/geodataset.png" alt="Example application in which we combine Landsat and CDL and sample from both"> <p>In this example, we show how easy it is to work with geospatial data and to sample small image patches from a combination of <a href="https://www.usgs.gov/landsat-missions">Landsat</a> and <a href="https://data.nal.usda.gov/dataset/cropscape-cropland-data-layer">Cropland Data Layer (CDL)</a> data using TorchGeo. First, we assume that the user has Landsat 7 and 8 imagery downloaded. Since Landsat 8 has more spectral bands than Landsat 7, we'll only use the bands that both satellites have in common. We'll create a single dataset including all images from both Landsat 7 and 8 data by taking the union between these two datasets.</p> <pre><code class="language-python">landsat7 = Landsat7(paths="...", bands=["B1", ..., "B7"]) landsat8 = Landsat8(paths="...", bands=["B2", ..., "B8"]) landsat = landsat7 | landsat8 </code></pre> <p>Next, we take the intersection between this dataset and the CDL dataset. We want to take the intersection instead of the union to ensure that we only sample from regions that have both Landsat and CDL data. Note that we can automatically download and checksum CDL data. Also note that each of these datasets may contain files in different coordinate reference systems (CRS) or resolutions, but TorchGeo automatically ensures that a matching CRS and resolution is used.</p> <pre><code class="language-python">cdl = CDL(paths="...", download=True, checksum=True) dataset = landsat &amp; cdl </code></pre> <p>This dataset can now be used with a PyTorch data loader. Unlike benchmark datasets, geospatial datasets often include very large images. For example, the CDL dataset consists of a single image covering the entire continental United States. In order to sample from these datasets using geospatial coordinates, TorchGeo defines a number of <a href="https://torchgeo.readthedocs.io/en/stable/api/samplers.html"><em>samplers</em></a>. In this example, we'll use a random sampler that returns 256 x 256 pixel images and 10,000 samples per epoch. We also use a custom collation function to combine each sample dictionary into a mini-batch of samples.</p> <pre><code class="language-python">sampler = RandomGeoSampler(dataset, size=256, length=10000) dataloader = DataLoader(dataset, batch_size=128, sampler=sampler, collate_fn=stack_samples) </code></pre> <p>This data loader can now be used in your normal training/evaluation pipeline.</p> <pre><code class="language-python">for batch in dataloader: image = batch["image"] mask = batch["mask"] # train a model, or make predictions using a pre-trained model </code></pre> <p>Many applications involve intelligently composing datasets based on geospatial metadata like this. For example, users may want to:</p> <ul> <li>Combine datasets for multiple image sources and treat them as equivalent (e.g., Landsat 7 and 8)</li> <li>Combine datasets for disparate geospatial locations (e.g., Chesapeake NY and PA)</li> </ul> <p>These combinations require that all queries are present in at least one dataset, and can be created using a <code>UnionDataset</code>. Similarly, users may want to:</p> <ul> <li>Combine image and target labels and sample from both simultaneously (e.g., Landsat and CDL)</li> <li>Combine datasets for multiple image sources for multimodal learning or data fusion (e.g., Landsat and Sentinel)</li> </ul> <p>These combinations require that all queries are present in both datasets, and can be created using an <code>IntersectionDataset</code>. TorchGeo automatically composes these datasets for you when you use the intersection (<code>&amp;</code>) and union (<code>|</code>) operators.</p> <h3>Benchmark datasets</h3> <p>TorchGeo includes a number of <a href="https://torchgeo.readthedocs.io/en/stable/api/datasets.html#non-geospatial-datasets"><em>benchmark datasets</em></a>—datasets that include both input images and target labels. This includes datasets for tasks like image classification, regression, semantic segmentation, object detection, instance segmentation, change detection, and more.</p> <p>If you've used <a href="https://pytorch.org/vision">torchvision</a> before, these datasets should seem very familiar. In this example, we'll create a dataset for the Northwestern Polytechnical University (NWPU) very-high-resolution ten-class (<a href="https://github.com/chaozhong2010/VHR-10_dataset_coco">VHR-10</a>) geospatial object detection dataset. This dataset can be automatically downloaded, checksummed, and extracted, just like with torchvision.</p> <pre><code class="language-python">from torch.utils.data import DataLoader from torchgeo.datamodules.utils import collate_fn_detection from torchgeo.datasets import VHR10 # Initialize the dataset dataset = VHR10(root="...", download=True, checksum=True) # Initialize the dataloader with the custom collate function dataloader = DataLoader( dataset, batch_size=128, shuffle=True, num_workers=4, collate_fn=collate_fn_detection, ) # Training loop for batch in dataloader: images = batch["image"] # list of images boxes = batch["boxes"] # list of boxes labels = batch["labels"] # list of labels masks = batch["masks"] # list of masks # train a model, or make predictions using a pre-trained model </code></pre> <img src="https://raw.githubusercontent.com/microsoft/torchgeo/main/images/vhr10.png" alt="Example predictions from a Mask R-CNN model trained on the VHR-10 dataset"> <p>All TorchGeo datasets are compatible with PyTorch data loaders, making them easy to integrate into existing training workflows. The only difference between a benchmark dataset in TorchGeo and a similar dataset in torchvision is that each dataset returns a dictionary with keys for each PyTorch <code>Tensor</code>.</p> <h3>Pre-trained Weights</h3> <p>Pre-trained weights have proven to be tremendously beneficial for transfer learning tasks in computer vision. Practitioners usually utilize models pre-trained on the ImageNet dataset, containing RGB images. However, remote sensing data often goes beyond RGB with additional multispectral channels that can vary across sensors. TorchGeo is the first library to support models pre-trained on different multispectral sensors, and adopts torchvision's <a href="https://pytorch.org/blog/introducing-torchvision-new-multi-weight-support-api/">multi-weight API</a>. A summary of currently available weights can be seen in the <a href="https://torchgeo.readthedocs.io/en/stable/api/models.html#pretrained-weights">docs</a>. To create a <a href="https://github.com/huggingface/pytorch-image-models">timm</a> Resnet-18 model with weights that have been pretrained on Sentinel-2 imagery, you can do the following:</p> <pre><code class="language-python">import timm from torchgeo.models import ResNet18_Weights weights = ResNet18_Weights.SENTINEL2_ALL_MOCO model = timm.create_model("resnet18", in_chans=weights.meta["in_chans"], num_classes=10) model.load_state_dict(weights.get_state_dict(progress=True), strict=False) </code></pre> <p>These weights can also directly be used in TorchGeo Lightning modules that are shown in the following section via the <code>weights</code> argument. For a notebook example, see this <a href="https://torchgeo.readthedocs.io/en/stable/tutorials/pretrained_weights.html">tutorial</a>.</p> <h3>Reproducibility with Lightning</h3> <p>In order to facilitate direct comparisons between results published in the literature and further reduce the boilerplate code needed to run experiments with datasets in TorchGeo, we have created Lightning <a href="https://torchgeo.readthedocs.io/en/stable/api/datamodules.html"><em>datamodules</em></a> with well-defined train-val-test splits and <a href="https://torchgeo.readthedocs.io/en/stable/api/trainers.html"><em>trainers</em></a> for various tasks like classification, regression, and semantic segmentation. These datamodules show how to incorporate augmentations from the kornia library, include preprocessing transforms (with pre-calculated channel statistics), and let users easily experiment with hyperparameters related to the data itself (as opposed to the modeling process). Training a semantic segmentation model on the <a href="https://project.inria.fr/aerialimagelabeling/">Inria Aerial Image Labeling</a> dataset is as easy as a few imports and four lines of code.</p> <pre><code class="language-python">datamodule = InriaAerialImageLabelingDataModule(root="...", batch_size=64, num_workers=6) task = SemanticSegmentationTask( model="unet", backbone="resnet50", weights=True, in_channels=3, num_classes=2, loss="ce", ignore_index=None, lr=0.1, patience=6, ) trainer = Trainer(default_root_dir="...") trainer.fit(model=task, datamodule=datamodule) </code></pre> <img src="https://raw.githubusercontent.com/microsoft/torchgeo/main/images/inria.png" alt="Building segmentations produced by a U-Net model trained on the Inria Aerial Image Labeling dataset"> <p>TorchGeo also supports command-line interface training using <a href="https://lightning.ai/docs/pytorch/stable/cli/lightning_cli.html">LightningCLI</a>. It can be invoked in two ways:</p> <pre><code class="language-console"># If torchgeo has been installed torchgeo # If torchgeo has been installed, or if it has been cloned to the current directory python3 -m torchgeo </code></pre> <p>It supports command-line configuration or YAML/JSON config files. Valid options can be found from the help messages:</p> <pre><code class="language-console"># See valid stages torchgeo --help # See valid trainer options torchgeo fit --help # See valid model options torchgeo fit --model.help ClassificationTask # See valid data options torchgeo fit --data.help EuroSAT100DataModule </code></pre> <p>Using the following config file:</p> <pre><code class="language-yaml">trainer: max_epochs: 20 model: class_path: ClassificationTask init_args: model: 'resnet18' in_channels: 13 num_classes: 10 data: class_path: EuroSAT100DataModule init_args: batch_size: 8 dict_kwargs: download: true </code></pre> <p>we can see the script in action:</p> <pre><code class="language-console"># Train and validate a model torchgeo fit --config config.yaml # Validate-only torchgeo validate --config config.yaml # Calculate and report test accuracy torchgeo test --config config.yaml --ckpt_path=... </code></pre> <p>It can also be imported and used in a Python script if you need to extend it to add new features:</p> <pre><code class="language-python">from torchgeo.main import main main(["fit", "--config", "config.yaml"]) </code></pre> <p>See the <a href="https://lightning.ai/docs/pytorch/stable/cli/lightning_cli.html">Lightning documentation</a> for more details.</p> <h2>Citation</h2> <p>If you use this software in your work, please cite our <a href="https://dl.acm.org/doi/10.1145/3557915.3560953">paper</a>:</p> <pre><code class="language-bibtex">@inproceedings{Stewart_TorchGeo_Deep_Learning_2022, address = {Seattle, Washington}, author = {Stewart, Adam J. and Robinson, Caleb and Corley, Isaac A. and Ortiz, Anthony and Lavista Ferres, Juan M. and Banerjee, Arindam}, booktitle = {Proceedings of the 30th International Conference on Advances in Geographic Information Systems}, doi = {10.1145/3557915.3560953}, month = nov, pages = {1--12}, publisher = {Association for Computing Machinery}, series = {SIGSPATIAL '22}, title = {{TorchGeo}: Deep Learning With Geospatial Data}, url = {https://dl.acm.org/doi/10.1145/3557915.3560953}, year = {2022} } </code></pre> <h2>Contributing</h2> <p>This project welcomes contributions and suggestions. If you would like to submit a pull request, see our <a href="https://torchgeo.readthedocs.io/en/stable/user/contributing.html">Contribution Guide</a> for more information.</p> <p>This project has adopted the <a href="https://opensource.microsoft.com/codeofconduct/">Microsoft Open Source Code of Conduct</a>. For more information see the <a href="https://opensource.microsoft.com/codeofconduct/faq/">Code of Conduct FAQ</a> or contact <a href="mailto:opencode@microsoft.com">opencode@microsoft.com</a> with any additional questions or comments.</p> \ No newline at end of file diff --git a/alloy/daily/index.xml b/alloy/daily/index.xml index eeb49587535..543757d88ba 100644 --- a/alloy/daily/index.xml +++ b/alloy/daily/index.xml @@ -1,7 +1,7 @@ GitHub Alloy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:04Z + 2024-12-10T01:28:55Z Daily Trending of Alloy in GitHub \ No newline at end of file diff --git a/alpine-abuild/daily/index.xml b/alpine-abuild/daily/index.xml index 144a03724ca..678cd80be9e 100644 --- a/alpine-abuild/daily/index.xml +++ b/alpine-abuild/daily/index.xml @@ -1,7 +1,7 @@ GitHub Alpine Abuild Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:04Z + 2024-12-10T01:28:54Z Daily Trending of Alpine Abuild in GitHub \ No newline at end of file diff --git a/altium-designer/daily/index.xml b/altium-designer/daily/index.xml index e63ac1eec11..1f9e592935f 100644 --- a/altium-designer/daily/index.xml +++ b/altium-designer/daily/index.xml @@ -1,7 +1,7 @@ GitHub Altium Designer Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:05Z + 2024-12-10T01:28:54Z Daily Trending of Altium Designer in GitHub \ No newline at end of file diff --git a/ampl/daily/index.xml b/ampl/daily/index.xml index e672bcfebca..b61a57d87ec 100644 --- a/ampl/daily/index.xml +++ b/ampl/daily/index.xml @@ -1,7 +1,7 @@ GitHub AMPL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:04Z + 2024-12-10T01:28:54Z Daily Trending of AMPL in GitHub \ No newline at end of file diff --git a/angelscript/daily/index.xml b/angelscript/daily/index.xml index bcfa1df3f94..6b0121858d5 100644 --- a/angelscript/daily/index.xml +++ b/angelscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub AngelScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:06Z + 2024-12-10T01:28:56Z Daily Trending of AngelScript in GitHub \ No newline at end of file diff --git a/ant-build-system/daily/index.xml b/ant-build-system/daily/index.xml index 64321c8aece..777d044a637 100644 --- a/ant-build-system/daily/index.xml +++ b/ant-build-system/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ant Build System Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:06Z + 2024-12-10T01:28:55Z Daily Trending of Ant Build System in GitHub \ No newline at end of file diff --git a/antlr/daily/index.xml b/antlr/daily/index.xml index 769088ad7d1..cfe99aaf1ca 100644 --- a/antlr/daily/index.xml +++ b/antlr/daily/index.xml @@ -1,7 +1,7 @@ GitHub ANTLR Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:06Z + 2024-12-10T01:28:56Z Daily Trending of ANTLR in GitHub \ No newline at end of file diff --git a/apacheconf/daily/index.xml b/apacheconf/daily/index.xml index 5c95fd0f060..cae563e6932 100644 --- a/apacheconf/daily/index.xml +++ b/apacheconf/daily/index.xml @@ -1,7 +1,7 @@ GitHub ApacheConf Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:07Z + 2024-12-10T01:28:58Z Daily Trending of ApacheConf in GitHub \ No newline at end of file diff --git a/apex/daily/index.xml b/apex/daily/index.xml index 92df0b93305..32dae870e3b 100644 --- a/apex/daily/index.xml +++ b/apex/daily/index.xml @@ -1,7 +1,7 @@ GitHub Apex Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:08Z + 2024-12-10T01:28:58Z Daily Trending of Apex in GitHub \ No newline at end of file diff --git a/api-blueprint/daily/index.xml b/api-blueprint/daily/index.xml index 8a9f4638886..935ecc33dee 100644 --- a/api-blueprint/daily/index.xml +++ b/api-blueprint/daily/index.xml @@ -1,7 +1,7 @@ GitHub API Blueprint Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:07Z + 2024-12-10T01:28:57Z Daily Trending of API Blueprint in GitHub \ No newline at end of file diff --git a/apl/daily/index.xml b/apl/daily/index.xml index 8fb9b013125..715f75ecb52 100644 --- a/apl/daily/index.xml +++ b/apl/daily/index.xml @@ -1,7 +1,7 @@ GitHub APL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:08Z + 2024-12-10T01:28:57Z Daily Trending of APL in GitHub \ No newline at end of file diff --git a/apollo-guidance-computer/daily/index.xml b/apollo-guidance-computer/daily/index.xml index 6e0ca3a7d0b..4b8e468345b 100644 --- a/apollo-guidance-computer/daily/index.xml +++ b/apollo-guidance-computer/daily/index.xml @@ -1,7 +1,7 @@ GitHub Apollo Guidance Computer Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:09Z + 2024-12-10T01:28:59Z Daily Trending of Apollo Guidance Computer in GitHub \ No newline at end of file diff --git a/applescript/daily/index.xml b/applescript/daily/index.xml index 74760ba7563..71483178752 100644 --- a/applescript/daily/index.xml +++ b/applescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub AppleScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:10Z + 2024-12-10T01:28:59Z Daily Trending of AppleScript in GitHub \ No newline at end of file diff --git a/arc/daily/index.xml b/arc/daily/index.xml index 64bf6a59de8..aaee8d8816c 100644 --- a/arc/daily/index.xml +++ b/arc/daily/index.xml @@ -1,7 +1,7 @@ GitHub Arc Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:09Z + 2024-12-10T01:28:59Z Daily Trending of Arc in GitHub \ No newline at end of file diff --git a/asciidoc/daily/index.xml b/asciidoc/daily/index.xml index 31356e3309e..5dcb82cb79c 100644 --- a/asciidoc/daily/index.xml +++ b/asciidoc/daily/index.xml @@ -1,7 +1,7 @@ GitHub AsciiDoc Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:09Z + 2024-12-10T01:28:59Z Daily Trending of AsciiDoc in GitHub \ No newline at end of file diff --git a/asl/daily/index.xml b/asl/daily/index.xml index 3842f71e685..9e68dd27711 100644 --- a/asl/daily/index.xml +++ b/asl/daily/index.xml @@ -1,7 +1,7 @@ GitHub ASL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:11Z + 2024-12-10T01:29:01Z Daily Trending of ASL in GitHub \ No newline at end of file diff --git a/asn.1/daily/index.xml b/asn.1/daily/index.xml index 053e2f9f629..676c04c4ebc 100644 --- a/asn.1/daily/index.xml +++ b/asn.1/daily/index.xml @@ -1,7 +1,7 @@ GitHub ASN.1 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:10Z + 2024-12-10T01:29:00Z Daily Trending of ASN.1 in GitHub \ No newline at end of file diff --git a/asp.net/daily/index.xml b/asp.net/daily/index.xml index 6ce99fe063b..49440795797 100644 --- a/asp.net/daily/index.xml +++ b/asp.net/daily/index.xml @@ -1,7 +1,7 @@ GitHub ASP.NET Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:10Z + 2024-12-10T01:29:01Z Daily Trending of ASP.NET in GitHub \ No newline at end of file diff --git a/aspectj/daily/index.xml b/aspectj/daily/index.xml index 7cac118ce12..c6ebef199d2 100644 --- a/aspectj/daily/index.xml +++ b/aspectj/daily/index.xml @@ -1,7 +1,7 @@ GitHub AspectJ Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:12Z + 2024-12-10T01:29:02Z Daily Trending of AspectJ in GitHub \ No newline at end of file diff --git a/assembly/daily/index.xml b/assembly/daily/index.xml index 596dc282c54..e71c86cbe93 100644 --- a/assembly/daily/index.xml +++ b/assembly/daily/index.xml @@ -1,7 +1,7 @@ GitHub Assembly Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:14Z + 2024-12-10T01:29:03Z Daily Trending of Assembly in GitHub \ No newline at end of file diff --git a/astro/daily/index.xml b/astro/daily/index.xml index 9a6f91746a7..a45caea9c1b 100644 --- a/astro/daily/index.xml +++ b/astro/daily/index.xml @@ -1,7 +1,7 @@ GitHub Astro Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:13Z + 2024-12-10T01:29:03Z Daily Trending of Astro in GitHub \ No newline at end of file diff --git a/asymptote/daily/index.xml b/asymptote/daily/index.xml index 4dc064a1ef6..10a0c9d3113 100644 --- a/asymptote/daily/index.xml +++ b/asymptote/daily/index.xml @@ -1,7 +1,7 @@ GitHub Asymptote Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:12Z + 2024-12-10T01:29:02Z Daily Trending of Asymptote in GitHub \ No newline at end of file diff --git a/ats/daily/index.xml b/ats/daily/index.xml index 18f7691c057..dc65d2dec6e 100644 --- a/ats/daily/index.xml +++ b/ats/daily/index.xml @@ -1,7 +1,7 @@ GitHub ATS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:14Z + 2024-12-10T01:29:04Z Daily Trending of ATS in GitHub \ No newline at end of file diff --git a/augeas/daily/index.xml b/augeas/daily/index.xml index bae918f6e8f..ed8d15459e5 100644 --- a/augeas/daily/index.xml +++ b/augeas/daily/index.xml @@ -1,7 +1,7 @@ GitHub Augeas Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:15Z + 2024-12-10T01:29:04Z Daily Trending of Augeas in GitHub \ No newline at end of file diff --git a/autohotkey/daily/index.xml b/autohotkey/daily/index.xml index 4d2310a8539..3508258bc57 100644 --- a/autohotkey/daily/index.xml +++ b/autohotkey/daily/index.xml @@ -1,7 +1,7 @@ GitHub AutoHotkey Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:15Z + 2024-12-10T01:29:05Z Daily Trending of AutoHotkey in GitHub \ No newline at end of file diff --git a/autoit/daily/index.xml b/autoit/daily/index.xml index 34ee1965e18..e8c65f09778 100644 --- a/autoit/daily/index.xml +++ b/autoit/daily/index.xml @@ -1,7 +1,7 @@ GitHub AutoIt Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:15Z + 2024-12-10T01:29:05Z Daily Trending of AutoIt in GitHub \ No newline at end of file diff --git a/avro-idl/daily/index.xml b/avro-idl/daily/index.xml index d3d7d8f5ae6..fe81757e16e 100644 --- a/avro-idl/daily/index.xml +++ b/avro-idl/daily/index.xml @@ -1,7 +1,7 @@ GitHub Avro IDL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:16Z + 2024-12-10T01:29:07Z Daily Trending of Avro IDL in GitHub \ No newline at end of file diff --git a/awk/daily/index.xml b/awk/daily/index.xml index dc4e00b0f8c..39d4ae478b0 100644 --- a/awk/daily/index.xml +++ b/awk/daily/index.xml @@ -1,7 +1,7 @@ GitHub Awk Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:17Z + 2024-12-10T01:29:06Z Daily Trending of Awk in GitHub \ No newline at end of file diff --git a/ballerina/daily/index.xml b/ballerina/daily/index.xml index 416a7fbd3f3..f30ec219952 100644 --- a/ballerina/daily/index.xml +++ b/ballerina/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ballerina Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:16Z + 2024-12-10T01:29:06Z Daily Trending of Ballerina in GitHub \ No newline at end of file diff --git a/basic/daily/index.xml b/basic/daily/index.xml index d852b0fea5a..d82ce0d8cc0 100644 --- a/basic/daily/index.xml +++ b/basic/daily/index.xml @@ -1,7 +1,7 @@ GitHub BASIC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:18Z + 2024-12-10T01:29:07Z Daily Trending of BASIC in GitHub \ No newline at end of file diff --git a/batchfile/daily/index.xml b/batchfile/daily/index.xml index 767db59956a..22850158fa4 100644 --- a/batchfile/daily/index.xml +++ b/batchfile/daily/index.xml @@ -1,7 +1,7 @@ GitHub Batchfile Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:19Z + 2024-12-10T01:29:08Z Daily Trending of Batchfile in GitHub \ No newline at end of file diff --git a/beef/daily/index.xml b/beef/daily/index.xml index 76fa737304d..c5e0c65a1ce 100644 --- a/beef/daily/index.xml +++ b/beef/daily/index.xml @@ -1,7 +1,7 @@ GitHub Beef Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:18Z + 2024-12-10T01:29:08Z Daily Trending of Beef in GitHub \ No newline at end of file diff --git a/befunge/daily/index.xml b/befunge/daily/index.xml index bc630fbb606..8749c06fbd0 100644 --- a/befunge/daily/index.xml +++ b/befunge/daily/index.xml @@ -1,7 +1,7 @@ GitHub Befunge Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:18Z + 2024-12-10T01:29:08Z Daily Trending of Befunge in GitHub \ No newline at end of file diff --git a/berry/daily/index.xml b/berry/daily/index.xml index 596583c3fcf..d1fc2818a5a 100644 --- a/berry/daily/index.xml +++ b/berry/daily/index.xml @@ -1,7 +1,7 @@ GitHub Berry Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:19Z + 2024-12-10T01:29:09Z Daily Trending of Berry in GitHub \ No newline at end of file diff --git a/bibtex/daily/index.xml b/bibtex/daily/index.xml index e09c33d5e36..d68faded8d1 100644 --- a/bibtex/daily/index.xml +++ b/bibtex/daily/index.xml @@ -1,7 +1,7 @@ GitHub BibTeX Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:20Z + 2024-12-10T01:29:09Z Daily Trending of BibTeX in GitHub \ No newline at end of file diff --git a/bicep/daily/index.xml b/bicep/daily/index.xml index 95d887b5a9f..ee5c70809c5 100644 --- a/bicep/daily/index.xml +++ b/bicep/daily/index.xml @@ -1,7 +1,14 @@ GitHub Bicep Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:20Z + 2024-12-10T01:29:10Z Daily Trending of Bicep in GitHub + + Azure-Samples/genai-gateway-apim + 2024-12-10T01:29:10Z + tag:github.com,2024-12-10:/Azure-Samples/genai-gateway-apim + + <p>Azure API Management (APIM) - Azure OpenAI Sample (Node.js)</p><hr> + \ No newline at end of file diff --git a/bison/daily/index.xml b/bison/daily/index.xml index 3d657487066..cfcf7b38c1c 100644 --- a/bison/daily/index.xml +++ b/bison/daily/index.xml @@ -1,7 +1,7 @@ GitHub Bison Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:21Z + 2024-12-10T01:29:11Z Daily Trending of Bison in GitHub \ No newline at end of file diff --git a/bitbake/daily/index.xml b/bitbake/daily/index.xml index e9b0855b489..02a9f361d31 100644 --- a/bitbake/daily/index.xml +++ b/bitbake/daily/index.xml @@ -1,7 +1,7 @@ GitHub BitBake Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:23Z + 2024-12-10T01:29:12Z Daily Trending of BitBake in GitHub \ No newline at end of file diff --git a/blade/daily/index.xml b/blade/daily/index.xml index d4b14caaa9e..3d07fb5a2f9 100644 --- a/blade/daily/index.xml +++ b/blade/daily/index.xml @@ -1,7 +1,7 @@ GitHub Blade Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:22Z + 2024-12-10T01:29:12Z Daily Trending of Blade in GitHub \ No newline at end of file diff --git a/blitzbasic/daily/index.xml b/blitzbasic/daily/index.xml index 52d0d0370c4..3cdcb0288a0 100644 --- a/blitzbasic/daily/index.xml +++ b/blitzbasic/daily/index.xml @@ -1,7 +1,7 @@ GitHub BlitzBasic Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:21Z + 2024-12-10T01:29:11Z Daily Trending of BlitzBasic in GitHub \ No newline at end of file diff --git a/blitzmax/daily/index.xml b/blitzmax/daily/index.xml index 95135b7f107..126748b1a3b 100644 --- a/blitzmax/daily/index.xml +++ b/blitzmax/daily/index.xml @@ -1,7 +1,7 @@ GitHub BlitzMax Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:25Z + 2024-12-10T01:29:14Z Daily Trending of BlitzMax in GitHub \ No newline at end of file diff --git a/bluespec/daily/index.xml b/bluespec/daily/index.xml index d08ba4e97ae..e64e6714552 100644 --- a/bluespec/daily/index.xml +++ b/bluespec/daily/index.xml @@ -1,7 +1,7 @@ GitHub Bluespec Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:25Z + 2024-12-10T01:29:13Z Daily Trending of Bluespec in GitHub \ No newline at end of file diff --git a/boo/daily/index.xml b/boo/daily/index.xml index dacea944ed9..7ebf0d226e5 100644 --- a/boo/daily/index.xml +++ b/boo/daily/index.xml @@ -1,7 +1,7 @@ GitHub Boo Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:24Z + 2024-12-10T01:29:13Z Daily Trending of Boo in GitHub \ No newline at end of file diff --git a/boogie/daily/index.xml b/boogie/daily/index.xml index 67f6530eff7..9d5ed1858d4 100644 --- a/boogie/daily/index.xml +++ b/boogie/daily/index.xml @@ -1,7 +1,7 @@ GitHub Boogie Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:25Z + 2024-12-10T01:29:14Z Daily Trending of Boogie in GitHub \ No newline at end of file diff --git a/brainfuck/daily/index.xml b/brainfuck/daily/index.xml index 7d334e7ad4c..bac78bf25e2 100644 --- a/brainfuck/daily/index.xml +++ b/brainfuck/daily/index.xml @@ -1,7 +1,7 @@ GitHub Brainfuck Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:26Z + 2024-12-10T01:29:15Z Daily Trending of Brainfuck in GitHub \ No newline at end of file diff --git a/brightscript/daily/index.xml b/brightscript/daily/index.xml index 06ef5578c4f..8c23fcc4124 100644 --- a/brightscript/daily/index.xml +++ b/brightscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub Brightscript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:28Z + 2024-12-10T01:29:17Z Daily Trending of Brightscript in GitHub \ No newline at end of file diff --git a/browserslist/daily/index.xml b/browserslist/daily/index.xml index 47663d188e6..0e7748304af 100644 --- a/browserslist/daily/index.xml +++ b/browserslist/daily/index.xml @@ -1,7 +1,7 @@ GitHub Browserslist Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:27Z + 2024-12-10T01:29:16Z Daily Trending of Browserslist in GitHub \ No newline at end of file diff --git a/c%23/daily/index.xml b/c%23/daily/index.xml index 0e29c3057ba..1fdb76ef25c 100644 --- a/c%23/daily/index.xml +++ b/c%23/daily/index.xml @@ -1,7 +1,7 @@ GitHub C# Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:39Z + 2024-12-10T01:29:30Z Daily Trending of C# in GitHub \ No newline at end of file diff --git a/c++/daily/index.xml b/c++/daily/index.xml index b0e0cb689a2..aeb329452da 100644 --- a/c++/daily/index.xml +++ b/c++/daily/index.xml @@ -1,14 +1,7 @@ GitHub C++ Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:35Z + 2024-12-10T01:29:34Z Daily Trending of C++ in GitHub - - ares-emulator/ares - 2024-12-09T01:29:35Z - tag:github.com,2024-12-09:/ares-emulator/ares - - <p>ares is a cross-platform, open source, multi-system emulator, focusing on accuracy and preservation.</p><hr><p><img src="https://github.com/ares-emulator/ares/raw/master/ares/ares/resource/logo.png" alt="ares logo"></p> <p><a href="https://github.com/higan-emu/ares/raw/master/LICENSE"><img src="https://img.shields.io/badge/License-ISC-blue.svg?sanitize=true" alt="License: ISC"></a></p> <p><strong>ares</strong> is a multi-system emulator that began development on October 14th, 2004. It is a descendant of <a href="https://github.com/higan-emu/higan">higan</a> and <a href="https://github.com/bsnes-emu/bsnes/">bsnes</a>, and focuses on accuracy and preservation.</p> <h2>Official Releases</h2> <p>Official releases are available from <a href="https://ares-emu.net">the ares website</a>.</p> <h2>Nightly Builds</h2> <p>Automated, untested builds of ares are available for Windows and macOS as a <a href="https://github.com/higan-emu/ares/releases/tag/nightly">pre-release</a>. Only the latest nightly build is kept.</p> <h2>Prerequisites</h2> <h3>*nix building</h3> <h6>Minimum required packages:</h6> <pre><code>g++ make pkg-config libgtk-3-dev libcanberra-gtk-module libgl-dev libasound2-dev </code></pre> <h6>Additional Audio Drivers</h6> <p>ares supports additional audio drivers besides the ALSA drivers included above. Installing these additional packages will allow them to be selected in Settings &gt; Drivers:<br> <code>libao-dev libopenal-dev</code></p> <h6>GTK2 &amp; GTK3</h6> <p>By default, GTK3 is used, but support for GTK2 is available. You will need to install the additional package <code>libgtk2.0-dev</code> as well as specifying the command line option <code>hiro=gtk2</code> at compile time.</p> <h6>SDL2 for input</h6> <p>If you would like to use SDL for input (e.g. for using a controller), you will need to install the <code>libsdl2-dev</code> and <code>libsdl2-2.0-0</code> packages and perform a clean build of ares. You should then be able to select SDL for input in the Settings &gt; Drivers menu.</p> <h5>Building with clang</h5> <p>clang++ is now the preferred compiler for ares. If clang is detected on Windows/macOS/BSD, it will be selected by default. On Linux and other platforms, g++ remains the default if present. To build with clang, it is necessary to install both the <code>clang</code> and <code>lld</code> packages. If you would like to manually specify a compiler, you can use the following option: <code>compiler=[g++|clang++]</code></p> <h5>Librashader Support</h5> <p>If you do not want to include librashader support, you can pass the following option to the <code>make</code> command to skip these requirements using: <code>librashader=false</code></p> <p>Librashader requires rust in order to build. You can install it with the following command:</p> <pre><code>curl --proto '=https' --tlsv1.2 -sSf https://sh.rustup.rs | sh source ~/.cargo/env rustup toolchain install nightly </code></pre> <p>In order to build librashader, change into the <code>ares/thirdparty/librashader</code> directory and run the script <code>build-librashader.sh</code> Note that once the build completes, it will instruct you to run three copy commands to install the library on your system. These paths may be different depending on Linux distribution.</p> <hr> <h3>Windows building</h3> <p>To build on Windows, using MSYS2 is recommended which can be download <a href="https://www.msys2.org/">here</a>. Follow the instructions on this page to install and setup an appropriate MINGW64 environment. Running the command:</p> <pre><code>pacman -S --needed base-devel mingw-w64-x86_64-toolchain mingw-w64-x86_64-SDL2 </code></pre> <p>from the MSYS2 MSYS terminal should setup everything you need to compile ares. Note that in order to compile, you will want to be in a MINGW64 terminal window after install and setup is complete.</p> <h5>Building with clang</h5> <p>clang is available through Visual Studio (or Build Tools for Visual Studio) through its installer and can be used to build ares. You will still need to supply GNU make in this instance. MSYS2 also offers a clang environment. You will want to make sure you select the clangw64 option during installation of MSYS2 which should provide and additional CLANG64 pre-configured environment. Install the clang toolchain package from the MSYS2 terminal:</p> <pre><code>pacman -S mingw-w64-clang-x86_64-toolchain mingw-w64-clang-x86_64-SDL2 </code></pre> <p>Once complete, open a CLANG64 terminal window and proceed with building ares.</p> <h6>Debug Symbols</h6> <p>When building with clang, by default symbols will be generated for debug builds using an MSVC compatible format (CodeView) for use with Windows debugging tools. In order to generate GDB compatible symbols, specify the following option: <code>symformat=gdb</code></p> <h6>Librashader Support</h6> <p>ares has introduced support for the <a href="https://github.com/SnowflakePowered/librashader">librashader</a> library, which is a preprocessor, compiler, and runtime for RetroArch 'slang' shaders. If you are not interested in working with librashaders, you can pass the following option to the <code>make</code> command to skip these requirements using: <code>librashader=false</code></p> <p>Building the librashader library on Windows requires Rust. Follow these steps to prepare your system and build the librashader library:</p> <ol> <li>Download and execute the rustup-init.exe installer from: <a href="https://rustup.rs/">https://rustup.rs/</a></li> <li>Open a new Windows terminal and run the following commands: <pre><code>rustup toolchain install nightly rustup default nightly </code></pre> </li> <li>With Rust successfully installed, you will need to update your PATH environment variable within your MSYS2 environment. In an MSYS2 shell, open $HOME/.bash_profile and append something like the following (note you will need to replace both instances of %USER_NAME% with the real user name you used to install Rust): <pre><code>if [ -d "/C/Users/%USER_NAME%/.cargo/bin" ] ; then PATH="/C/Users/%USER_NAME%/.cargo/bin:${PATH}" fi </code></pre> </li> <li>Open a new MSYS2 based shell for the compiler you are using (MinGW64|CLANG64|UCRT64), execute <code>rustup</code> to validate the path is set properly within your MSYS2 environment.</li> <li>In your MSYS2 compiler shell, <code>cd</code> into the <code>ares/thirdparty/librashader</code> directory</li> <li>Execute the build script, build should complete successfully: <pre><code>./build-librashader.sh </code></pre> </li> </ol> <p>This only needs to be done once, or anytime the librashader library is updated. Once built, ares will build with librashader support by default requiring no additional flags.</p> <h2>Compilation</h2> <p>Check out the source code by running this command:</p> <pre><code>git clone https://github.com/ares-emulator/ares.git </code></pre> <p>From the root of the project directory run:</p> <pre><code>make -j4 </code></pre> <p><code>-j#</code> indicates number of parallel build processes, and shouldn't be set higher than N-1 cores on your processor. Specifying this option can significantly decrease the time to build this project. There are multiple build types available and it defaults to an 'optimized' build. Build types can be specified using: <code>build=[debug|stable|release|minified|optimized]</code></p> <p>Build options can be found in the following two make files: nall/GNUmakefile desktop-ui/GNUmakefile</p> <p>To start compilation from the beginning, run the following prior to compiling:</p> <pre><code>make clean </code></pre> <h4>Building specific cores</h4> <p>If you would like to build a subset of cores, you can specify the <code>cores="core1 core2"</code> option. Currently available cores:</p> <pre><code>a26 fc sfc n64 sg ms md ps1 pce ng msx cv myvision gb gba ws ngp spec </code></pre> <h2>Build Output</h2> <p>There is a single binary produced at the end of compilation which can be found in <code>desktop-ui/out</code>. On OS's besides Linux, the <code>Database</code> &amp; <code>Shader</code> directories are copied over here as well. On Linux, running <code>make install</code> after compilation will copy these directories and binary into suitable locations (see desktop-ui/GNUmakefile for details). Alternatively, these directories can be copied from <code>thirdparty/slang-shaders/*</code> into a <code>Shader</code> directory, and by copying <code>mia/Database/*</code></p> <h2>Command-line options</h2> <p>When started from the command-line, ares accepts a few options.</p> <pre><code>Usage: ./ares [options] game(s) --help Displays available options and exit --fullscreen Start in full screen mode --system system Specify the system name --shader shader Specify GLSL shader name to load (requires OpenGL driver) --setting name=value Specify a value for a setting --dump-all-settings Show a list of all existing settings and exit --no-file-prompt Do not prompt to load (optional) additional roms (eg: 64DD) </code></pre> <p>The --system option is useful when the system type cannot be auto-detected. --fullscreen will only have an effect if a game is also passed in argument.</p> <p>Example: <code>ares --system MSX examples.rom --fullscreen</code></p> <p>Specifying multiple games allows for multi-cart support. For example, to load the Super GameBoy BIOS and a game in one command (to avoid a file prompt), you can do:</p> <p><code>ares "Super GameBoy.sfc" "Super Mario Land.gb"</code></p> <p>The --no-file-prompt option is useful if you wish to launch a game from CLI without being prompted to load additional roms. For example, some Nintendo 64 games optionally support 64DD expansion disks, so this option can be used to suppress the "64DD Disk" file dialog, and assume any secondary content is disconnected.</p> <h2>High-level Components</h2> <ul> <li><strong>ares</strong>: emulator cores and component implementations</li> <li><strong>desktop-ui</strong>: main GUI implementation for this project</li> <li><strong>hiro</strong>: cross-platform GUI toolkit that utilizes native APIs on supported platforms</li> <li><strong>nall</strong>: Near's alternative to the C++ standard library</li> <li><strong>ruby</strong>: interface between a hiro application and platform-specific APIs for emulator video, audio, and input</li> <li><strong>mia</strong>: internal ROM database and ROM/image loader</li> <li><strong>libco</strong>: cooperative multithreading library</li> </ul> <h2>Contributing</h2> <p>Please join our discord to chat with other ares developers: <a href="https://discord.com/invite/gz2quhk2kv">https://discord.com/invite/gz2quhk2kv</a></p> - \ No newline at end of file diff --git a/c-objdump/daily/index.xml b/c-objdump/daily/index.xml index ce22cbca5a3..872c9bef921 100644 --- a/c-objdump/daily/index.xml +++ b/c-objdump/daily/index.xml @@ -1,7 +1,7 @@ GitHub C-ObjDump Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:33Z + 2024-12-10T01:29:29Z Daily Trending of C-ObjDump in GitHub \ No newline at end of file diff --git a/c/daily/index.xml b/c/daily/index.xml index 8d243eeba2c..819d88aacf3 100644 --- a/c/daily/index.xml +++ b/c/daily/index.xml @@ -1,7 +1,7 @@ GitHub C Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:29Z + 2024-12-10T01:29:18Z Daily Trending of C in GitHub \ No newline at end of file diff --git a/c2hs-haskell/daily/index.xml b/c2hs-haskell/daily/index.xml index a672d381f30..e4d040c5a77 100644 --- a/c2hs-haskell/daily/index.xml +++ b/c2hs-haskell/daily/index.xml @@ -1,7 +1,7 @@ GitHub C2hs Haskell Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:32Z + 2024-12-10T01:29:28Z Daily Trending of C2hs Haskell in GitHub \ No newline at end of file diff --git a/cabal-config/daily/index.xml b/cabal-config/daily/index.xml index 47291846023..7dd66d8b71a 100644 --- a/cabal-config/daily/index.xml +++ b/cabal-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cabal Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:43Z + 2024-12-10T01:29:39Z Daily Trending of Cabal Config in GitHub \ No newline at end of file diff --git a/cadence/daily/index.xml b/cadence/daily/index.xml index 066b656aff5..2570beec9d3 100644 --- a/cadence/daily/index.xml +++ b/cadence/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cadence Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:43Z + 2024-12-10T01:29:38Z Daily Trending of Cadence in GitHub \ No newline at end of file diff --git a/cairo/daily/index.xml b/cairo/daily/index.xml index 499234004fc..63330ca4583 100644 --- a/cairo/daily/index.xml +++ b/cairo/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cairo Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:43Z + 2024-12-10T01:29:38Z Daily Trending of Cairo in GitHub \ No newline at end of file diff --git a/cap'n-proto/daily/index.xml b/cap'n-proto/daily/index.xml index 16b5c00d375..a794a02dfd0 100644 --- a/cap'n-proto/daily/index.xml +++ b/cap'n-proto/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cap'n Proto Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:45Z + 2024-12-10T01:29:40Z Daily Trending of Cap'n Proto in GitHub \ No newline at end of file diff --git a/cartocss/daily/index.xml b/cartocss/daily/index.xml index 82833cb5d5a..82ce5d13e19 100644 --- a/cartocss/daily/index.xml +++ b/cartocss/daily/index.xml @@ -1,7 +1,7 @@ GitHub CartoCSS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:46Z + 2024-12-10T01:29:42Z Daily Trending of CartoCSS in GitHub \ No newline at end of file diff --git a/ceylon/daily/index.xml b/ceylon/daily/index.xml index 3e88d98d78e..838e7c269c9 100644 --- a/ceylon/daily/index.xml +++ b/ceylon/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ceylon Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:47Z + 2024-12-10T01:29:41Z Daily Trending of Ceylon in GitHub \ No newline at end of file diff --git a/chapel/daily/index.xml b/chapel/daily/index.xml index 1b7f2296501..2e35ea847c6 100644 --- a/chapel/daily/index.xml +++ b/chapel/daily/index.xml @@ -1,7 +1,7 @@ GitHub Chapel Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:47Z + 2024-12-10T01:29:41Z Daily Trending of Chapel in GitHub \ No newline at end of file diff --git a/charity/daily/index.xml b/charity/daily/index.xml index d9d1499160f..d4aee919185 100644 --- a/charity/daily/index.xml +++ b/charity/daily/index.xml @@ -1,7 +1,7 @@ GitHub Charity Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:48Z + 2024-12-10T01:29:43Z Daily Trending of Charity in GitHub \ No newline at end of file diff --git a/chuck/daily/index.xml b/chuck/daily/index.xml index e707990d82b..17b23006b97 100644 --- a/chuck/daily/index.xml +++ b/chuck/daily/index.xml @@ -1,7 +1,7 @@ GitHub ChucK Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:48Z + 2024-12-10T01:29:43Z Daily Trending of ChucK in GitHub \ No newline at end of file diff --git a/cil/daily/index.xml b/cil/daily/index.xml index de665064825..08d544d4417 100644 --- a/cil/daily/index.xml +++ b/cil/daily/index.xml @@ -1,7 +1,7 @@ GitHub CIL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:48Z + 2024-12-10T01:29:43Z Daily Trending of CIL in GitHub \ No newline at end of file diff --git a/cirru/daily/index.xml b/cirru/daily/index.xml index b9cc5785cd0..b02a3322c9b 100644 --- a/cirru/daily/index.xml +++ b/cirru/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cirru Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:49Z + 2024-12-10T01:29:44Z Daily Trending of Cirru in GitHub \ No newline at end of file diff --git a/clarion/daily/index.xml b/clarion/daily/index.xml index 3126541fa3f..74689e1ca2c 100644 --- a/clarion/daily/index.xml +++ b/clarion/daily/index.xml @@ -1,7 +1,7 @@ GitHub Clarion Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:50Z + 2024-12-10T01:29:44Z Daily Trending of Clarion in GitHub \ No newline at end of file diff --git a/clarity/daily/index.xml b/clarity/daily/index.xml index cd7d5cbbcb4..b48d22e8a51 100644 --- a/clarity/daily/index.xml +++ b/clarity/daily/index.xml @@ -1,7 +1,7 @@ GitHub Clarity Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:50Z + 2024-12-10T01:29:45Z Daily Trending of Clarity in GitHub \ No newline at end of file diff --git a/classic-asp/daily/index.xml b/classic-asp/daily/index.xml index c3ea59775e5..b5fa8f8eccb 100644 --- a/classic-asp/daily/index.xml +++ b/classic-asp/daily/index.xml @@ -1,7 +1,7 @@ GitHub Classic ASP Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:11Z + 2024-12-10T01:29:00Z Daily Trending of Classic ASP in GitHub \ No newline at end of file diff --git a/clean/daily/index.xml b/clean/daily/index.xml index eac53d5dc0a..8b5e6ce9c98 100644 --- a/clean/daily/index.xml +++ b/clean/daily/index.xml @@ -1,7 +1,7 @@ GitHub Clean Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:51Z + 2024-12-10T01:29:46Z Daily Trending of Clean in GitHub \ No newline at end of file diff --git a/click/daily/index.xml b/click/daily/index.xml index 2a527f2a566..0da521d495e 100644 --- a/click/daily/index.xml +++ b/click/daily/index.xml @@ -1,7 +1,7 @@ GitHub Click Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:51Z + 2024-12-10T01:29:46Z Daily Trending of Click in GitHub \ No newline at end of file diff --git a/clips/daily/index.xml b/clips/daily/index.xml index ca364f879dd..7f86f8f13e6 100644 --- a/clips/daily/index.xml +++ b/clips/daily/index.xml @@ -1,7 +1,7 @@ GitHub CLIPS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:51Z + 2024-12-10T01:29:46Z Daily Trending of CLIPS in GitHub \ No newline at end of file diff --git a/clojure/daily/index.xml b/clojure/daily/index.xml index 38f4a8e3615..70c6d596f66 100644 --- a/clojure/daily/index.xml +++ b/clojure/daily/index.xml @@ -1,7 +1,7 @@ GitHub Clojure Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:52Z + 2024-12-10T01:29:47Z Daily Trending of Clojure in GitHub \ No newline at end of file diff --git a/closure-templates/daily/index.xml b/closure-templates/daily/index.xml index 429f0e737c8..b1d332809e0 100644 --- a/closure-templates/daily/index.xml +++ b/closure-templates/daily/index.xml @@ -1,7 +1,7 @@ GitHub Closure Templates Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:53Z + 2024-12-10T01:29:48Z Daily Trending of Closure Templates in GitHub \ No newline at end of file diff --git a/cloud-firestore-security-rules/daily/index.xml b/cloud-firestore-security-rules/daily/index.xml index 30afe532e9b..cbadd5f8e5b 100644 --- a/cloud-firestore-security-rules/daily/index.xml +++ b/cloud-firestore-security-rules/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cloud Firestore Security Rules Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:53Z + 2024-12-10T01:29:47Z Daily Trending of Cloud Firestore Security Rules in GitHub \ No newline at end of file diff --git a/cmake/daily/index.xml b/cmake/daily/index.xml index 2c46ce00ac8..0886e0635b5 100644 --- a/cmake/daily/index.xml +++ b/cmake/daily/index.xml @@ -1,7 +1,7 @@ GitHub CMake Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:54Z + 2024-12-10T01:29:48Z Daily Trending of CMake in GitHub \ No newline at end of file diff --git a/cobol/daily/index.xml b/cobol/daily/index.xml index 3a0e00ba588..646e983056f 100644 --- a/cobol/daily/index.xml +++ b/cobol/daily/index.xml @@ -1,7 +1,7 @@ GitHub COBOL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:53Z + 2024-12-10T01:29:49Z Daily Trending of COBOL in GitHub \ No newline at end of file diff --git a/codeowners/daily/index.xml b/codeowners/daily/index.xml index def40ae119b..a2599eca1a4 100644 --- a/codeowners/daily/index.xml +++ b/codeowners/daily/index.xml @@ -1,7 +1,7 @@ GitHub CODEOWNERS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:54Z + 2024-12-10T01:29:49Z Daily Trending of CODEOWNERS in GitHub \ No newline at end of file diff --git a/codeql/daily/index.xml b/codeql/daily/index.xml index 76c9a87daee..e92a4534370 100644 --- a/codeql/daily/index.xml +++ b/codeql/daily/index.xml @@ -1,7 +1,7 @@ GitHub CodeQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:55Z + 2024-12-10T01:29:50Z Daily Trending of CodeQL in GitHub \ No newline at end of file diff --git a/coffeescript/daily/index.xml b/coffeescript/daily/index.xml index 8ff8e469714..6915809aaff 100644 --- a/coffeescript/daily/index.xml +++ b/coffeescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub CoffeeScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:55Z + 2024-12-10T01:29:51Z Daily Trending of CoffeeScript in GitHub \ No newline at end of file diff --git a/coldfusion-cfc/daily/index.xml b/coldfusion-cfc/daily/index.xml index e18c6c22db7..ddb289d93e3 100644 --- a/coldfusion-cfc/daily/index.xml +++ b/coldfusion-cfc/daily/index.xml @@ -1,7 +1,7 @@ GitHub ColdFusion CFC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:57Z + 2024-12-10T01:29:51Z Daily Trending of ColdFusion CFC in GitHub \ No newline at end of file diff --git a/coldfusion/daily/index.xml b/coldfusion/daily/index.xml index 681935e2e5d..a2c823ca717 100644 --- a/coldfusion/daily/index.xml +++ b/coldfusion/daily/index.xml @@ -1,7 +1,7 @@ GitHub ColdFusion Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:55Z + 2024-12-10T01:29:50Z Daily Trending of ColdFusion in GitHub \ No newline at end of file diff --git a/collada/daily/index.xml b/collada/daily/index.xml index 6ba493ccc47..f06598369bf 100644 --- a/collada/daily/index.xml +++ b/collada/daily/index.xml @@ -1,7 +1,7 @@ GitHub COLLADA Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:57Z + 2024-12-10T01:29:51Z Daily Trending of COLLADA in GitHub \ No newline at end of file diff --git a/common-lisp/daily/index.xml b/common-lisp/daily/index.xml index 2c956e4d1ef..a57c2a47d6b 100644 --- a/common-lisp/daily/index.xml +++ b/common-lisp/daily/index.xml @@ -1,7 +1,7 @@ GitHub Common Lisp Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:57Z + 2024-12-10T01:29:52Z Daily Trending of Common Lisp in GitHub \ No newline at end of file diff --git a/common-workflow-language/daily/index.xml b/common-workflow-language/daily/index.xml index ed95873ccf1..8dd74628142 100644 --- a/common-workflow-language/daily/index.xml +++ b/common-workflow-language/daily/index.xml @@ -1,7 +1,7 @@ GitHub Common Workflow Language Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:56Z + 2024-12-10T01:29:52Z Daily Trending of Common Workflow Language in GitHub \ No newline at end of file diff --git a/component-pascal/daily/index.xml b/component-pascal/daily/index.xml index f299d570890..eebd5a4ad69 100644 --- a/component-pascal/daily/index.xml +++ b/component-pascal/daily/index.xml @@ -1,7 +1,7 @@ GitHub Component Pascal Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:00Z + 2024-12-10T01:29:54Z Daily Trending of Component Pascal in GitHub \ No newline at end of file diff --git a/conll-u/daily/index.xml b/conll-u/daily/index.xml index 21a983a4242..1d82add1706 100644 --- a/conll-u/daily/index.xml +++ b/conll-u/daily/index.xml @@ -1,7 +1,7 @@ GitHub CoNLL-U Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:59Z + 2024-12-10T01:29:54Z Daily Trending of CoNLL-U in GitHub \ No newline at end of file diff --git a/cool/daily/index.xml b/cool/daily/index.xml index f31036ebd36..ba24f39735e 100644 --- a/cool/daily/index.xml +++ b/cool/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cool Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:59Z + 2024-12-10T01:29:54Z Daily Trending of Cool in GitHub \ No newline at end of file diff --git a/coq/daily/index.xml b/coq/daily/index.xml index d8b05d3b3c8..51bf21177ba 100644 --- a/coq/daily/index.xml +++ b/coq/daily/index.xml @@ -1,7 +1,7 @@ GitHub Coq Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:59Z + 2024-12-10T01:29:55Z Daily Trending of Coq in GitHub \ No newline at end of file diff --git a/cpp-objdump/daily/index.xml b/cpp-objdump/daily/index.xml index 276188f8dd3..08333d9f944 100644 --- a/cpp-objdump/daily/index.xml +++ b/cpp-objdump/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cpp-ObjDump Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:01Z + 2024-12-10T01:29:56Z Daily Trending of Cpp-ObjDump in GitHub \ No newline at end of file diff --git a/creole/daily/index.xml b/creole/daily/index.xml index 91822dc4b81..6aa99cf38ee 100644 --- a/creole/daily/index.xml +++ b/creole/daily/index.xml @@ -1,7 +1,7 @@ GitHub Creole Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:01Z + 2024-12-10T01:29:55Z Daily Trending of Creole in GitHub \ No newline at end of file diff --git a/crystal/daily/index.xml b/crystal/daily/index.xml index 41d3615e4e6..f74893dbf38 100644 --- a/crystal/daily/index.xml +++ b/crystal/daily/index.xml @@ -1,7 +1,7 @@ GitHub Crystal Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:01Z + 2024-12-10T01:29:56Z Daily Trending of Crystal in GitHub \ No newline at end of file diff --git a/cson/daily/index.xml b/cson/daily/index.xml index 0147f3fe9d6..feaba875ba3 100644 --- a/cson/daily/index.xml +++ b/cson/daily/index.xml @@ -1,7 +1,7 @@ GitHub CSON Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:03Z + 2024-12-10T01:29:57Z Daily Trending of CSON in GitHub \ No newline at end of file diff --git a/csound-document/daily/index.xml b/csound-document/daily/index.xml index 1365534ee7a..563892fcea4 100644 --- a/csound-document/daily/index.xml +++ b/csound-document/daily/index.xml @@ -1,7 +1,7 @@ GitHub Csound Document Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:02Z + 2024-12-10T01:29:58Z Daily Trending of Csound Document in GitHub \ No newline at end of file diff --git a/csound-score/daily/index.xml b/csound-score/daily/index.xml index 3b080a9ef78..68180bd8051 100644 --- a/csound-score/daily/index.xml +++ b/csound-score/daily/index.xml @@ -1,7 +1,7 @@ GitHub Csound Score Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:02Z + 2024-12-10T01:29:57Z Daily Trending of Csound Score in GitHub \ No newline at end of file diff --git a/csound/daily/index.xml b/csound/daily/index.xml index f33fdb50fe6..af6a6afeebf 100644 --- a/csound/daily/index.xml +++ b/csound/daily/index.xml @@ -1,7 +1,7 @@ GitHub Csound Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:03Z + 2024-12-10T01:29:58Z Daily Trending of Csound in GitHub \ No newline at end of file diff --git a/css/daily/index.xml b/css/daily/index.xml index a9d212f0b32..831cb8f048b 100644 --- a/css/daily/index.xml +++ b/css/daily/index.xml @@ -1,7 +1,7 @@ GitHub CSS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:06Z + 2024-12-10T01:30:00Z Daily Trending of CSS in GitHub \ No newline at end of file diff --git a/csv/daily/index.xml b/csv/daily/index.xml index 703c4adea65..152d56833da 100644 --- a/csv/daily/index.xml +++ b/csv/daily/index.xml @@ -1,7 +1,7 @@ GitHub CSV Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:04Z + 2024-12-10T01:29:58Z Daily Trending of CSV in GitHub \ No newline at end of file diff --git a/cuda/daily/index.xml b/cuda/daily/index.xml index 8166d346038..560736269aa 100644 --- a/cuda/daily/index.xml +++ b/cuda/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cuda Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:06Z + 2024-12-10T01:30:00Z Daily Trending of Cuda in GitHub \ No newline at end of file diff --git a/cue/daily/index.xml b/cue/daily/index.xml index 84f808b4ccd..a568f4af72d 100644 --- a/cue/daily/index.xml +++ b/cue/daily/index.xml @@ -1,7 +1,7 @@ GitHub CUE Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:04Z + 2024-12-10T01:29:59Z Daily Trending of CUE in GitHub \ No newline at end of file diff --git a/curl-config/daily/index.xml b/curl-config/daily/index.xml index 9d33f88f593..ae13439c379 100644 --- a/curl-config/daily/index.xml +++ b/curl-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub cURL Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:08Z + 2024-12-10T01:30:03Z Daily Trending of cURL Config in GitHub \ No newline at end of file diff --git a/curry/daily/index.xml b/curry/daily/index.xml index 46ce47fa1bd..838a78ccf68 100644 --- a/curry/daily/index.xml +++ b/curry/daily/index.xml @@ -1,7 +1,7 @@ GitHub Curry Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:09Z + 2024-12-10T01:30:04Z Daily Trending of Curry in GitHub \ No newline at end of file diff --git a/cweb/daily/index.xml b/cweb/daily/index.xml index c516dbcc810..50bcd786a44 100644 --- a/cweb/daily/index.xml +++ b/cweb/daily/index.xml @@ -1,7 +1,7 @@ GitHub CWeb Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:09Z + 2024-12-10T01:30:04Z Daily Trending of CWeb in GitHub \ No newline at end of file diff --git a/cycript/daily/index.xml b/cycript/daily/index.xml index 01f9850083a..da65d41dd55 100644 --- a/cycript/daily/index.xml +++ b/cycript/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cycript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:10Z + 2024-12-10T01:30:05Z Daily Trending of Cycript in GitHub \ No newline at end of file diff --git a/cython/daily/index.xml b/cython/daily/index.xml index 567a7fef15a..5115ca21a10 100644 --- a/cython/daily/index.xml +++ b/cython/daily/index.xml @@ -1,7 +1,7 @@ GitHub Cython Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:11Z + 2024-12-10T01:30:06Z Daily Trending of Cython in GitHub \ No newline at end of file diff --git a/d-objdump/daily/index.xml b/d-objdump/daily/index.xml index 128775e5f1c..0a3d5436146 100644 --- a/d-objdump/daily/index.xml +++ b/d-objdump/daily/index.xml @@ -1,7 +1,7 @@ GitHub D-ObjDump Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:12Z + 2024-12-10T01:30:06Z Daily Trending of D-ObjDump in GitHub \ No newline at end of file diff --git a/d/daily/index.xml b/d/daily/index.xml index 97ed84ddd16..a2a7876264c 100644 --- a/d/daily/index.xml +++ b/d/daily/index.xml @@ -1,7 +1,7 @@ GitHub D Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:12Z + 2024-12-10T01:30:08Z Daily Trending of D in GitHub \ No newline at end of file diff --git a/dafny/daily/index.xml b/dafny/daily/index.xml index 0386aa47385..b1ce63301a9 100644 --- a/dafny/daily/index.xml +++ b/dafny/daily/index.xml @@ -1,7 +1,7 @@ GitHub Dafny Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:12Z + 2024-12-10T01:30:07Z Daily Trending of Dafny in GitHub \ No newline at end of file diff --git a/darcs-patch/daily/index.xml b/darcs-patch/daily/index.xml index bfee15063c1..25982e3217d 100644 --- a/darcs-patch/daily/index.xml +++ b/darcs-patch/daily/index.xml @@ -1,7 +1,7 @@ GitHub Darcs Patch Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:13Z + 2024-12-10T01:30:09Z Daily Trending of Darcs Patch in GitHub \ No newline at end of file diff --git a/dart/daily/index.xml b/dart/daily/index.xml index fef609fff6b..7e3c473f187 100644 --- a/dart/daily/index.xml +++ b/dart/daily/index.xml @@ -1,7 +1,7 @@ GitHub Dart Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:16Z + 2024-12-10T01:30:10Z Daily Trending of Dart in GitHub \ No newline at end of file diff --git a/dataweave/daily/index.xml b/dataweave/daily/index.xml index 400184577ae..84dc36b2d40 100644 --- a/dataweave/daily/index.xml +++ b/dataweave/daily/index.xml @@ -1,7 +1,7 @@ GitHub DataWeave Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:14Z + 2024-12-10T01:30:08Z Daily Trending of DataWeave in GitHub \ No newline at end of file diff --git a/debian-package-control-file/daily/index.xml b/debian-package-control-file/daily/index.xml index 37a4add2b47..409bbeeba83 100644 --- a/debian-package-control-file/daily/index.xml +++ b/debian-package-control-file/daily/index.xml @@ -1,7 +1,7 @@ GitHub Debian Package Control File Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:13Z + 2024-12-10T01:30:08Z Daily Trending of Debian Package Control File in GitHub \ No newline at end of file diff --git a/denizenscript/daily/index.xml b/denizenscript/daily/index.xml index 8db8fdbd809..88df284da91 100644 --- a/denizenscript/daily/index.xml +++ b/denizenscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub DenizenScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:20Z + 2024-12-10T01:30:13Z Daily Trending of DenizenScript in GitHub \ No newline at end of file diff --git a/desktop/daily/index.xml b/desktop/daily/index.xml index 5042e3bdc59..d36ff3cedbf 100644 --- a/desktop/daily/index.xml +++ b/desktop/daily/index.xml @@ -1,7 +1,7 @@ GitHub desktop Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:19Z + 2024-12-10T01:30:13Z Daily Trending of desktop in GitHub \ No newline at end of file diff --git a/dhall/daily/index.xml b/dhall/daily/index.xml index c2600f8fd07..fdbf13af439 100644 --- a/dhall/daily/index.xml +++ b/dhall/daily/index.xml @@ -1,7 +1,7 @@ GitHub Dhall Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:20Z + 2024-12-10T01:30:13Z Daily Trending of Dhall in GitHub \ No newline at end of file diff --git a/diff/daily/index.xml b/diff/daily/index.xml index 633cefe4a31..024886fa7a0 100644 --- a/diff/daily/index.xml +++ b/diff/daily/index.xml @@ -1,7 +1,7 @@ GitHub Diff Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:19Z + 2024-12-10T01:30:12Z Daily Trending of Diff in GitHub \ No newline at end of file diff --git a/digital-command-language/daily/index.xml b/digital-command-language/daily/index.xml index af90819a733..ab302c726bb 100644 --- a/digital-command-language/daily/index.xml +++ b/digital-command-language/daily/index.xml @@ -1,7 +1,7 @@ GitHub DIGITAL Command Language Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:22Z + 2024-12-10T01:30:15Z Daily Trending of DIGITAL Command Language in GitHub \ No newline at end of file diff --git a/dircolors/daily/index.xml b/dircolors/daily/index.xml index 5f67ea33fc5..36ecc267c26 100644 --- a/dircolors/daily/index.xml +++ b/dircolors/daily/index.xml @@ -1,7 +1,7 @@ GitHub dircolors Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:21Z + 2024-12-10T01:30:14Z Daily Trending of dircolors in GitHub \ No newline at end of file diff --git a/directx-3d-file/daily/index.xml b/directx-3d-file/daily/index.xml index e999ceafa1d..dff17f6237b 100644 --- a/directx-3d-file/daily/index.xml +++ b/directx-3d-file/daily/index.xml @@ -1,7 +1,7 @@ GitHub DirectX 3D File Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:22Z + 2024-12-10T01:30:14Z Daily Trending of DirectX 3D File in GitHub \ No newline at end of file diff --git a/dm/daily/index.xml b/dm/daily/index.xml index 5a09a520bcd..85ce8708dc5 100644 --- a/dm/daily/index.xml +++ b/dm/daily/index.xml @@ -1,7 +1,7 @@ GitHub DM Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:21Z + 2024-12-10T01:30:15Z Daily Trending of DM in GitHub \ No newline at end of file diff --git a/dns-zone/daily/index.xml b/dns-zone/daily/index.xml index 410dad39163..c389aaeeb2b 100644 --- a/dns-zone/daily/index.xml +++ b/dns-zone/daily/index.xml @@ -1,7 +1,7 @@ GitHub DNS Zone Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:23Z + 2024-12-10T01:30:16Z Daily Trending of DNS Zone in GitHub \ No newline at end of file diff --git a/dockerfile/daily/index.xml b/dockerfile/daily/index.xml index e89b4b2f1c7..eb01d700f13 100644 --- a/dockerfile/daily/index.xml +++ b/dockerfile/daily/index.xml @@ -1,7 +1,7 @@ GitHub Dockerfile Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:24Z + 2024-12-10T01:30:17Z Daily Trending of Dockerfile in GitHub \ No newline at end of file diff --git a/dogescript/daily/index.xml b/dogescript/daily/index.xml index 67c08fb504f..bd8d5514432 100644 --- a/dogescript/daily/index.xml +++ b/dogescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub Dogescript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:23Z + 2024-12-10T01:30:16Z Daily Trending of Dogescript in GitHub \ No newline at end of file diff --git a/dtrace/daily/index.xml b/dtrace/daily/index.xml index 5dfb4dd38cc..3b86aa46782 100644 --- a/dtrace/daily/index.xml +++ b/dtrace/daily/index.xml @@ -1,7 +1,7 @@ GitHub DTrace Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:41Z + 2024-12-10T01:30:23Z Daily Trending of DTrace in GitHub \ No newline at end of file diff --git a/dylan/daily/index.xml b/dylan/daily/index.xml index 8ffafd227f5..32c3f616a85 100644 --- a/dylan/daily/index.xml +++ b/dylan/daily/index.xml @@ -1,7 +1,7 @@ GitHub Dylan Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:42Z + 2024-12-10T01:30:23Z Daily Trending of Dylan in GitHub \ No newline at end of file diff --git a/e-mail/daily/index.xml b/e-mail/daily/index.xml index ccdbe1515cf..6b5aeb33275 100644 --- a/e-mail/daily/index.xml +++ b/e-mail/daily/index.xml @@ -1,7 +1,7 @@ GitHub E-mail Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:44Z + 2024-12-10T01:30:25Z Daily Trending of E-mail in GitHub \ No newline at end of file diff --git a/e/daily/index.xml b/e/daily/index.xml index 2772c26ebed..b031d881d73 100644 --- a/e/daily/index.xml +++ b/e/daily/index.xml @@ -1,7 +1,7 @@ GitHub E Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:42Z + 2024-12-10T01:30:22Z Daily Trending of E in GitHub \ No newline at end of file diff --git a/eagle/daily/index.xml b/eagle/daily/index.xml index 458b9b897be..a8b57785b27 100644 --- a/eagle/daily/index.xml +++ b/eagle/daily/index.xml @@ -1,7 +1,7 @@ GitHub Eagle Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:43Z + 2024-12-10T01:30:24Z Daily Trending of Eagle in GitHub \ No newline at end of file diff --git a/earthly/daily/index.xml b/earthly/daily/index.xml index 5c3ca0b2c0c..579df7d27ad 100644 --- a/earthly/daily/index.xml +++ b/earthly/daily/index.xml @@ -1,7 +1,7 @@ GitHub Earthly Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:43Z + 2024-12-10T01:30:25Z Daily Trending of Earthly in GitHub \ No newline at end of file diff --git a/easybuild/daily/index.xml b/easybuild/daily/index.xml index 8b96de155dc..6cd4abdcd3b 100644 --- a/easybuild/daily/index.xml +++ b/easybuild/daily/index.xml @@ -1,7 +1,7 @@ GitHub Easybuild Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:44Z + 2024-12-10T01:30:24Z Daily Trending of Easybuild in GitHub \ No newline at end of file diff --git a/ebnf/daily/index.xml b/ebnf/daily/index.xml index 3d36dcc4d56..67d938ce710 100644 --- a/ebnf/daily/index.xml +++ b/ebnf/daily/index.xml @@ -1,7 +1,7 @@ GitHub EBNF Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:45Z + 2024-12-10T01:30:27Z Daily Trending of EBNF in GitHub \ No newline at end of file diff --git a/ec/daily/index.xml b/ec/daily/index.xml index 66639652d66..426a2c00930 100644 --- a/ec/daily/index.xml +++ b/ec/daily/index.xml @@ -1,7 +1,7 @@ GitHub eC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:45Z + 2024-12-10T01:30:26Z Daily Trending of eC in GitHub \ No newline at end of file diff --git a/ecere-projects/daily/index.xml b/ecere-projects/daily/index.xml index 195c0ebed7c..2821ee13a07 100644 --- a/ecere-projects/daily/index.xml +++ b/ecere-projects/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ecere Projects Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:46Z + 2024-12-10T01:30:26Z Daily Trending of Ecere Projects in GitHub \ No newline at end of file diff --git a/ecl/daily/index.xml b/ecl/daily/index.xml index 4c3d34ff862..5db8d830037 100644 --- a/ecl/daily/index.xml +++ b/ecl/daily/index.xml @@ -1,7 +1,7 @@ GitHub ECL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:46Z + 2024-12-10T01:30:25Z Daily Trending of ECL in GitHub \ No newline at end of file diff --git a/eclipse/daily/index.xml b/eclipse/daily/index.xml index a929effeeff..316a38fbefe 100644 --- a/eclipse/daily/index.xml +++ b/eclipse/daily/index.xml @@ -1,7 +1,7 @@ GitHub ECLiPSe Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:47Z + 2024-12-10T01:30:28Z Daily Trending of ECLiPSe in GitHub \ No newline at end of file diff --git a/editorconfig/daily/index.xml b/editorconfig/daily/index.xml index 97d341770ec..5403def9052 100644 --- a/editorconfig/daily/index.xml +++ b/editorconfig/daily/index.xml @@ -1,7 +1,7 @@ GitHub EditorConfig Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:49Z + 2024-12-10T01:30:29Z Daily Trending of EditorConfig in GitHub \ No newline at end of file diff --git a/edje-data-collection/daily/index.xml b/edje-data-collection/daily/index.xml index 70c927247da..5174a78f04b 100644 --- a/edje-data-collection/daily/index.xml +++ b/edje-data-collection/daily/index.xml @@ -1,7 +1,7 @@ GitHub Edje Data Collection Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:49Z + 2024-12-10T01:30:29Z Daily Trending of Edje Data Collection in GitHub \ No newline at end of file diff --git a/edn/daily/index.xml b/edn/daily/index.xml index 024082e9d7c..bf36c567569 100644 --- a/edn/daily/index.xml +++ b/edn/daily/index.xml @@ -1,7 +1,7 @@ GitHub edn Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:49Z + 2024-12-10T01:30:30Z Daily Trending of edn in GitHub \ No newline at end of file diff --git a/eiffel/daily/index.xml b/eiffel/daily/index.xml index d7a136ca88e..f4ec552de14 100644 --- a/eiffel/daily/index.xml +++ b/eiffel/daily/index.xml @@ -1,7 +1,7 @@ GitHub Eiffel Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:50Z + 2024-12-10T01:30:29Z Daily Trending of Eiffel in GitHub \ No newline at end of file diff --git a/ejs/daily/index.xml b/ejs/daily/index.xml index 4a33eb3704b..d7ad9b44eb8 100644 --- a/ejs/daily/index.xml +++ b/ejs/daily/index.xml @@ -1,7 +1,7 @@ GitHub EJS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:51Z + 2024-12-10T01:30:31Z Daily Trending of EJS in GitHub \ No newline at end of file diff --git a/elixir/daily/index.xml b/elixir/daily/index.xml index ac478548081..4d4dc53281b 100644 --- a/elixir/daily/index.xml +++ b/elixir/daily/index.xml @@ -1,7 +1,7 @@ GitHub Elixir Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:52Z + 2024-12-10T01:30:32Z Daily Trending of Elixir in GitHub \ No newline at end of file diff --git a/elm/daily/index.xml b/elm/daily/index.xml index 4fa7406c401..615b3be5394 100644 --- a/elm/daily/index.xml +++ b/elm/daily/index.xml @@ -1,7 +1,7 @@ GitHub Elm Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:51Z + 2024-12-10T01:30:31Z Daily Trending of Elm in GitHub \ No newline at end of file diff --git a/emacs-lisp/daily/index.xml b/emacs-lisp/daily/index.xml index 6c99ce655f6..8e0a1c5d600 100644 --- a/emacs-lisp/daily/index.xml +++ b/emacs-lisp/daily/index.xml @@ -1,7 +1,7 @@ GitHub Emacs Lisp Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:55Z + 2024-12-10T01:30:35Z Daily Trending of Emacs Lisp in GitHub \ No newline at end of file diff --git a/emberscript/daily/index.xml b/emberscript/daily/index.xml index 130dbe23279..2720e6a5b10 100644 --- a/emberscript/daily/index.xml +++ b/emberscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub EmberScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:54Z + 2024-12-10T01:30:33Z Daily Trending of EmberScript in GitHub \ No newline at end of file diff --git a/eq/daily/index.xml b/eq/daily/index.xml index 64f6da163f2..720967ed731 100644 --- a/eq/daily/index.xml +++ b/eq/daily/index.xml @@ -1,7 +1,7 @@ GitHub EQ Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:30:53Z + 2024-12-10T01:30:33Z Daily Trending of EQ in GitHub \ No newline at end of file diff --git a/erlang/daily/index.xml b/erlang/daily/index.xml index 8d8816007d2..dfa2c773211 100644 --- a/erlang/daily/index.xml +++ b/erlang/daily/index.xml @@ -1,14 +1,7 @@ GitHub Erlang Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:04Z + 2024-12-10T01:30:42Z Daily Trending of Erlang in GitHub - - mojombo/yaws - 2024-12-09T01:31:04Z - tag:github.com,2024-12-09:/mojombo/yaws - - <p>YAWS is an erlang web server</p><hr> - \ No newline at end of file diff --git a/euphoria/daily/index.xml b/euphoria/daily/index.xml index 3620e88eb1e..67581789595 100644 --- a/euphoria/daily/index.xml +++ b/euphoria/daily/index.xml @@ -1,7 +1,7 @@ GitHub Euphoria Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:02Z + 2024-12-10T01:30:40Z Daily Trending of Euphoria in GitHub \ No newline at end of file diff --git a/f%23/daily/index.xml b/f%23/daily/index.xml index b84c82e2097..df4a1860137 100644 --- a/f%23/daily/index.xml +++ b/f%23/daily/index.xml @@ -1,7 +1,7 @@ GitHub F# Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:03Z + 2024-12-10T01:30:40Z Daily Trending of F# in GitHub \ No newline at end of file diff --git a/f*/daily/index.xml b/f*/daily/index.xml index d2e224da227..146010aa45c 100644 --- a/f*/daily/index.xml +++ b/f*/daily/index.xml @@ -1,7 +1,7 @@ GitHub F* Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:03Z + 2024-12-10T01:30:40Z Daily Trending of F* in GitHub \ No newline at end of file diff --git a/factor/daily/index.xml b/factor/daily/index.xml index 86fd2d3e0a3..faffc718fe2 100644 --- a/factor/daily/index.xml +++ b/factor/daily/index.xml @@ -1,7 +1,7 @@ GitHub Factor Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:05Z + 2024-12-10T01:30:43Z Daily Trending of Factor in GitHub \ No newline at end of file diff --git a/fancy/daily/index.xml b/fancy/daily/index.xml index 56f7f2cc8cd..f1976a32802 100644 --- a/fancy/daily/index.xml +++ b/fancy/daily/index.xml @@ -1,7 +1,7 @@ GitHub Fancy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:04Z + 2024-12-10T01:30:42Z Daily Trending of Fancy in GitHub \ No newline at end of file diff --git a/fantom/daily/index.xml b/fantom/daily/index.xml index 5185ebb836d..1dde213101c 100644 --- a/fantom/daily/index.xml +++ b/fantom/daily/index.xml @@ -1,7 +1,7 @@ GitHub Fantom Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:05Z + 2024-12-10T01:30:43Z Daily Trending of Fantom in GitHub \ No newline at end of file diff --git a/faust/daily/index.xml b/faust/daily/index.xml index 0ff4aae696d..458bed24fdf 100644 --- a/faust/daily/index.xml +++ b/faust/daily/index.xml @@ -1,7 +1,7 @@ GitHub Faust Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:06Z + 2024-12-10T01:30:43Z Daily Trending of Faust in GitHub \ No newline at end of file diff --git a/fennel/daily/index.xml b/fennel/daily/index.xml index f9787ae764b..b17b8289e4a 100644 --- a/fennel/daily/index.xml +++ b/fennel/daily/index.xml @@ -1,7 +1,7 @@ GitHub Fennel Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:08Z + 2024-12-10T01:30:45Z Daily Trending of Fennel in GitHub \ No newline at end of file diff --git a/figlet-font/daily/index.xml b/figlet-font/daily/index.xml index 81c42c04c7b..fa909e33f03 100644 --- a/figlet-font/daily/index.xml +++ b/figlet-font/daily/index.xml @@ -1,7 +1,7 @@ GitHub FIGlet Font Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:06Z + 2024-12-10T01:30:44Z Daily Trending of FIGlet Font in GitHub \ No newline at end of file diff --git a/filebench-wml/daily/index.xml b/filebench-wml/daily/index.xml index 2bf345be27e..a722195e38c 100644 --- a/filebench-wml/daily/index.xml +++ b/filebench-wml/daily/index.xml @@ -1,7 +1,7 @@ GitHub Filebench WML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:07Z + 2024-12-10T01:30:44Z Daily Trending of Filebench WML in GitHub \ No newline at end of file diff --git a/filterscript/daily/index.xml b/filterscript/daily/index.xml index 9096b035da8..c84963ce7da 100644 --- a/filterscript/daily/index.xml +++ b/filterscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub Filterscript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:07Z + 2024-12-10T01:30:45Z Daily Trending of Filterscript in GitHub \ No newline at end of file diff --git a/fish/daily/index.xml b/fish/daily/index.xml index de415a74b20..7f749f7911b 100644 --- a/fish/daily/index.xml +++ b/fish/daily/index.xml @@ -1,7 +1,7 @@ GitHub fish Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:09Z + 2024-12-10T01:30:46Z Daily Trending of fish in GitHub \ No newline at end of file diff --git a/fluent/daily/index.xml b/fluent/daily/index.xml index f1ddd6f0b85..1260f594dbf 100644 --- a/fluent/daily/index.xml +++ b/fluent/daily/index.xml @@ -1,7 +1,7 @@ GitHub Fluent Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:09Z + 2024-12-10T01:30:47Z Daily Trending of Fluent in GitHub \ No newline at end of file diff --git a/flux/daily/index.xml b/flux/daily/index.xml index f0cfb92cc4e..d3cfd1ff195 100644 --- a/flux/daily/index.xml +++ b/flux/daily/index.xml @@ -1,7 +1,7 @@ GitHub FLUX Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:08Z + 2024-12-10T01:30:46Z Daily Trending of FLUX in GitHub \ No newline at end of file diff --git a/formatted/daily/index.xml b/formatted/daily/index.xml index abd23b37e06..2c8e17930c4 100644 --- a/formatted/daily/index.xml +++ b/formatted/daily/index.xml @@ -1,7 +1,7 @@ GitHub Formatted Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:10Z + 2024-12-10T01:30:47Z Daily Trending of Formatted in GitHub \ No newline at end of file diff --git a/forth/daily/index.xml b/forth/daily/index.xml index 485ca2678f5..6bf788549fd 100644 --- a/forth/daily/index.xml +++ b/forth/daily/index.xml @@ -1,7 +1,7 @@ GitHub Forth Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:10Z + 2024-12-10T01:30:48Z Daily Trending of Forth in GitHub \ No newline at end of file diff --git a/fortran-free-form/daily/index.xml b/fortran-free-form/daily/index.xml index 79e621b95c8..7a803d23a15 100644 --- a/fortran-free-form/daily/index.xml +++ b/fortran-free-form/daily/index.xml @@ -1,7 +1,7 @@ GitHub Fortran Free Form Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:11Z + 2024-12-10T01:30:47Z Daily Trending of Fortran Free Form in GitHub \ No newline at end of file diff --git a/fortran/daily/index.xml b/fortran/daily/index.xml index 0a40f112603..96a51db37cd 100644 --- a/fortran/daily/index.xml +++ b/fortran/daily/index.xml @@ -1,7 +1,7 @@ GitHub Fortran Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:12Z + 2024-12-10T01:30:48Z Daily Trending of Fortran in GitHub \ No newline at end of file diff --git a/freebasic/daily/index.xml b/freebasic/daily/index.xml index 9c82e419fb3..399a1276ad1 100644 --- a/freebasic/daily/index.xml +++ b/freebasic/daily/index.xml @@ -1,7 +1,7 @@ GitHub FreeBASIC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:13Z + 2024-12-10T01:30:50Z Daily Trending of FreeBASIC in GitHub \ No newline at end of file diff --git a/freemarker/daily/index.xml b/freemarker/daily/index.xml index 4542429dad6..f7dab630cc1 100644 --- a/freemarker/daily/index.xml +++ b/freemarker/daily/index.xml @@ -1,7 +1,7 @@ GitHub FreeMarker Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:12Z + 2024-12-10T01:30:49Z Daily Trending of FreeMarker in GitHub \ No newline at end of file diff --git a/frege/daily/index.xml b/frege/daily/index.xml index 17b06a661a9..eab3a21b34f 100644 --- a/frege/daily/index.xml +++ b/frege/daily/index.xml @@ -1,7 +1,7 @@ GitHub Frege Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:13Z + 2024-12-10T01:30:49Z Daily Trending of Frege in GitHub \ No newline at end of file diff --git a/futhark/daily/index.xml b/futhark/daily/index.xml index 2335dcb8998..bc0836d1633 100644 --- a/futhark/daily/index.xml +++ b/futhark/daily/index.xml @@ -1,7 +1,7 @@ GitHub Futhark Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:13Z + 2024-12-10T01:30:49Z Daily Trending of Futhark in GitHub \ No newline at end of file diff --git a/g-code/daily/index.xml b/g-code/daily/index.xml index f2ff4435995..ab6acf402aa 100644 --- a/g-code/daily/index.xml +++ b/g-code/daily/index.xml @@ -1,7 +1,7 @@ GitHub G-code Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:15Z + 2024-12-10T01:30:51Z Daily Trending of G-code in GitHub \ No newline at end of file diff --git a/game-maker-language/daily/index.xml b/game-maker-language/daily/index.xml index bd0e4a00911..1e55a252f12 100644 --- a/game-maker-language/daily/index.xml +++ b/game-maker-language/daily/index.xml @@ -1,7 +1,7 @@ GitHub Game Maker Language Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:15Z + 2024-12-10T01:30:51Z Daily Trending of Game Maker Language in GitHub \ No newline at end of file diff --git a/gaml/daily/index.xml b/gaml/daily/index.xml index 9bac6d6a1f9..7bad6e99d01 100644 --- a/gaml/daily/index.xml +++ b/gaml/daily/index.xml @@ -1,7 +1,7 @@ GitHub GAML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:14Z + 2024-12-10T01:30:50Z Daily Trending of GAML in GitHub \ No newline at end of file diff --git a/gams/daily/index.xml b/gams/daily/index.xml index 5d8caa78ecd..dada71f3870 100644 --- a/gams/daily/index.xml +++ b/gams/daily/index.xml @@ -1,7 +1,7 @@ GitHub GAMS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:15Z + 2024-12-10T01:30:50Z Daily Trending of GAMS in GitHub \ No newline at end of file diff --git a/gap/daily/index.xml b/gap/daily/index.xml index fcdbb329313..82d97bbe2cd 100644 --- a/gap/daily/index.xml +++ b/gap/daily/index.xml @@ -1,7 +1,7 @@ GitHub GAP Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:16Z + 2024-12-10T01:30:52Z Daily Trending of GAP in GitHub \ No newline at end of file diff --git a/gcc-machine-description/daily/index.xml b/gcc-machine-description/daily/index.xml index 70f33863de0..f2a1c5ffb5b 100644 --- a/gcc-machine-description/daily/index.xml +++ b/gcc-machine-description/daily/index.xml @@ -1,7 +1,7 @@ GitHub GCC Machine Description Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:17Z + 2024-12-10T01:30:52Z Daily Trending of GCC Machine Description in GitHub \ No newline at end of file diff --git a/gdb/daily/index.xml b/gdb/daily/index.xml index 79cfa11b328..c118375f2ca 100644 --- a/gdb/daily/index.xml +++ b/gdb/daily/index.xml @@ -1,7 +1,7 @@ GitHub GDB Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:16Z + 2024-12-10T01:30:52Z Daily Trending of GDB in GitHub \ No newline at end of file diff --git a/gdscript/daily/index.xml b/gdscript/daily/index.xml index 0a6f2c48376..96ea3bb8aa9 100644 --- a/gdscript/daily/index.xml +++ b/gdscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub GDScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:17Z + 2024-12-10T01:30:53Z Daily Trending of GDScript in GitHub \ No newline at end of file diff --git a/gedcom/daily/index.xml b/gedcom/daily/index.xml index 8596c8c3540..25d286a3112 100644 --- a/gedcom/daily/index.xml +++ b/gedcom/daily/index.xml @@ -1,7 +1,7 @@ GitHub GEDCOM Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:18Z + 2024-12-10T01:30:54Z Daily Trending of GEDCOM in GitHub \ No newline at end of file diff --git a/gemfile.lock/daily/index.xml b/gemfile.lock/daily/index.xml index 626d64b691b..5318733266e 100644 --- a/gemfile.lock/daily/index.xml +++ b/gemfile.lock/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gemfile.lock Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:19Z + 2024-12-10T01:30:54Z Daily Trending of Gemfile.lock in GitHub \ No newline at end of file diff --git a/genie/daily/index.xml b/genie/daily/index.xml index b72e1f0422a..15f12b22d73 100644 --- a/genie/daily/index.xml +++ b/genie/daily/index.xml @@ -1,7 +1,7 @@ GitHub Genie Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:20Z + 2024-12-10T01:30:55Z Daily Trending of Genie in GitHub \ No newline at end of file diff --git a/genshi/daily/index.xml b/genshi/daily/index.xml index 5aa12466198..1935c01a0d7 100644 --- a/genshi/daily/index.xml +++ b/genshi/daily/index.xml @@ -1,7 +1,7 @@ GitHub Genshi Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:20Z + 2024-12-10T01:30:56Z Daily Trending of Genshi in GitHub \ No newline at end of file diff --git a/gentoo-ebuild/daily/index.xml b/gentoo-ebuild/daily/index.xml index 003d5e5d909..0d46a2fd4b1 100644 --- a/gentoo-ebuild/daily/index.xml +++ b/gentoo-ebuild/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gentoo Ebuild Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:20Z + 2024-12-10T01:30:56Z Daily Trending of Gentoo Ebuild in GitHub \ No newline at end of file diff --git a/gentoo-eclass/daily/index.xml b/gentoo-eclass/daily/index.xml index 72d608d89f1..547b4411b64 100644 --- a/gentoo-eclass/daily/index.xml +++ b/gentoo-eclass/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gentoo Eclass Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:22Z + 2024-12-10T01:30:57Z Daily Trending of Gentoo Eclass in GitHub \ No newline at end of file diff --git a/gerber-image/daily/index.xml b/gerber-image/daily/index.xml index 5534769d953..39de7e50cad 100644 --- a/gerber-image/daily/index.xml +++ b/gerber-image/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gerber Image Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:21Z + 2024-12-10T01:30:58Z Daily Trending of Gerber Image in GitHub \ No newline at end of file diff --git a/gettext-catalog/daily/index.xml b/gettext-catalog/daily/index.xml index e6fceefcff3..f56f668ac43 100644 --- a/gettext-catalog/daily/index.xml +++ b/gettext-catalog/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gettext Catalog Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:22Z + 2024-12-10T01:30:57Z Daily Trending of Gettext Catalog in GitHub \ No newline at end of file diff --git a/gherkin/daily/index.xml b/gherkin/daily/index.xml index 87dcaba708d..362d1cd7ac3 100644 --- a/gherkin/daily/index.xml +++ b/gherkin/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gherkin Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:22Z + 2024-12-10T01:30:57Z Daily Trending of Gherkin in GitHub \ No newline at end of file diff --git a/git-attributes/daily/index.xml b/git-attributes/daily/index.xml index 94b059db346..9bdae9741da 100644 --- a/git-attributes/daily/index.xml +++ b/git-attributes/daily/index.xml @@ -1,7 +1,7 @@ GitHub Git Attributes Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:24Z + 2024-12-10T01:30:59Z Daily Trending of Git Attributes in GitHub \ No newline at end of file diff --git a/git-config/daily/index.xml b/git-config/daily/index.xml index cf7c7b18fbc..3349bea7459 100644 --- a/git-config/daily/index.xml +++ b/git-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub Git Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:23Z + 2024-12-10T01:30:59Z Daily Trending of Git Config in GitHub \ No newline at end of file diff --git a/gleam/daily/index.xml b/gleam/daily/index.xml index 06dd9a564a6..3ca44ba830d 100644 --- a/gleam/daily/index.xml +++ b/gleam/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gleam Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:24Z + 2024-12-10T01:30:58Z Daily Trending of Gleam in GitHub \ No newline at end of file diff --git a/glsl/daily/index.xml b/glsl/daily/index.xml index 07ca0f10ab0..899305cc675 100644 --- a/glsl/daily/index.xml +++ b/glsl/daily/index.xml @@ -1,7 +1,7 @@ GitHub GLSL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:26Z + 2024-12-10T01:31:01Z Daily Trending of GLSL in GitHub \ No newline at end of file diff --git a/glyph-bitmap-distribution-format/daily/index.xml b/glyph-bitmap-distribution-format/daily/index.xml index 25c759852c5..60a93f9614d 100644 --- a/glyph-bitmap-distribution-format/daily/index.xml +++ b/glyph-bitmap-distribution-format/daily/index.xml @@ -1,7 +1,7 @@ GitHub Glyph Bitmap Distribution Format Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:27Z + 2024-12-10T01:31:02Z Daily Trending of Glyph Bitmap Distribution Format in GitHub \ No newline at end of file diff --git a/glyph/daily/index.xml b/glyph/daily/index.xml index b34bbcb2779..c8059dbfcc0 100644 --- a/glyph/daily/index.xml +++ b/glyph/daily/index.xml @@ -1,7 +1,7 @@ GitHub Glyph Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:25Z + 2024-12-10T01:31:00Z Daily Trending of Glyph in GitHub \ No newline at end of file diff --git a/gn/daily/index.xml b/gn/daily/index.xml index 76d679718f5..8da58d16cf7 100644 --- a/gn/daily/index.xml +++ b/gn/daily/index.xml @@ -1,7 +1,7 @@ GitHub GN Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:27Z + 2024-12-10T01:31:02Z Daily Trending of GN in GitHub \ No newline at end of file diff --git a/gnuplot/daily/index.xml b/gnuplot/daily/index.xml index 4e2eb861fbf..313f1ab2758 100644 --- a/gnuplot/daily/index.xml +++ b/gnuplot/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gnuplot Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:27Z + 2024-12-10T01:31:02Z Daily Trending of Gnuplot in GitHub \ No newline at end of file diff --git a/go-checksums/daily/index.xml b/go-checksums/daily/index.xml index 80964e27915..c0ca63e4d55 100644 --- a/go-checksums/daily/index.xml +++ b/go-checksums/daily/index.xml @@ -1,7 +1,7 @@ GitHub Go Checksums Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:33Z + 2024-12-10T01:31:11Z Daily Trending of Go Checksums in GitHub \ No newline at end of file diff --git a/go-module/daily/index.xml b/go-module/daily/index.xml index 6b8c3da697b..afa6a3d1702 100644 --- a/go-module/daily/index.xml +++ b/go-module/daily/index.xml @@ -1,7 +1,7 @@ GitHub Go Module Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:34Z + 2024-12-10T01:31:10Z Daily Trending of Go Module in GitHub \ No newline at end of file diff --git a/go/daily/index.xml b/go/daily/index.xml index e9957c56fda..e7edd376746 100644 --- a/go/daily/index.xml +++ b/go/daily/index.xml @@ -1,7 +1,14 @@ GitHub Go Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:29Z + 2024-12-10T01:31:03Z Daily Trending of Go in GitHub + + D3Ext/Hooka + 2024-12-10T01:31:03Z + tag:github.com,2024-12-10:/D3Ext/Hooka + + <p>Shellcode loader generator with multiples features</p><hr><p align="center"> </p> <h1 align="center">Hooka</h1> <h4 align="center">Shellcode loader generator with multiples features</h4> <h6 align="center">Coded with 💙 by D3Ext</h6> <p></p> <p align="center"> <a href="https://opensource.org/licenses/MIT"> <img src="https://img.shields.io/badge/license-MIT-_red.svg?sanitize=true"> </a> <a href="https://github.com/D3Ext/Hooka/raw/main/CHANGELOG.md"> <img src="https://img.shields.io/badge/maintained%3F-yes-brightgreen.svg?sanitize=true"> </a> <a href="https://github.com/D3Ext/go-recon/issues"> <img src="https://img.shields.io/badge/contributions-welcome-brightgreen.svg?style=flat"> </a> </p> <p align="center"> <a href="https://raw.githubusercontent.com/D3Ext/Hooka/main/#introduction">Introduction</a> • <a href="https://raw.githubusercontent.com/D3Ext/Hooka/main/#features">Features</a> • <a href="https://raw.githubusercontent.com/D3Ext/Hooka/main/#usage">Usage</a> • <a href="https://raw.githubusercontent.com/D3Ext/Hooka/main/#library">Library</a> • <a href="https://raw.githubusercontent.com/D3Ext/Hooka/main/#disclaimer">Disclaimer</a> </p> <h1>Introduction</h1> <p>Hooka is able to generate shellcode loaders with multiple capabilities. It is also based on other tools like <a href="https://github.com/boku7/BokuLoader">BokuLoader</a>, <a href="https://github.com/optiv/Freeze">Freeze</a> or <a href="https://github.com/icyguider/Shhhloader">Shhhloader</a>, and it tries to implement more evasion features. Why in Golang? Why not?</p> <h1>Features</h1> <p>This tool is able to generate loaders with this features:</p> <ul> <li> <p>Multiple shellcode injection techniques:</p> <ul> <li>SuspendedProcess</li> <li>ProcessHollowing</li> <li>NtCreateThreadEx</li> <li>EtwpCreateEtwThread</li> <li>NtQueueApcThreadEx</li> <li>No-RWX</li> </ul> </li> <li> <p>Get shellcode from raw file, PE, DLL or from a URL</p> </li> <li> <p>EXE and DLL are supported as output loader formats</p> </li> <li> <p>Encrypt shellcode using:</p> <ul> <li>AES</li> <li>3DES</li> <li>RC4</li> <li>XOR</li> </ul> </li> <li> <p>AMSI and ETW patching (enabled by default)</p> </li> <li> <p>Random variables and function names</p> </li> <li> <p>Shikata Ga Nai obfuscation (see <a href="https://github.com/EgeBalci/sgn">here</a>)</p> </li> <li> <p>Multiple ways to detect sandboxing</p> </li> <li> <p>Enable ACG Guard protection</p> </li> <li> <p>Block non-Microsoft signed DLLs from injecting into created processes</p> </li> <li> <p>Capable of unhooking user-mode hooks via multiple techniques:</p> <ul> <li>Classic</li> <li>Full DLL</li> <li>Perun's Fart technique</li> </ul> </li> <li> <p><em><strong>Phant0m</strong></em> technique to suspend EventLog threads (see <a href="https://github.com/hlldz/Phant0m">here</a>)</p> </li> <li> <p>Windows API hashing (see <a href="https://www.ired.team/offensive-security/defense-evasion/windows-api-hashing-in-malware">here</a>)</p> </li> <li> <p>Sign shellcode loader with fake or real certificates</p> </li> <li> <p>Strings obfuscation via Caesar cipher (see <a href="https://en.wikipedia.org/wiki/Caesar_cipher">here</a>)</p> </li> <li> <p>Compress code weight using Golang compile and UPX (if it's installed)</p> </li> <li> <p>Compute binary entropy of the loader</p> </li> <li> <p>Compute MD5, SHA1 and SHA256 checksums to keep track of the loader</p> </li> </ul> <h1>Installation</h1> <p>Just clone the repository like this:</p> <pre><code class="language-sh">git clone https://github.com/D3Ext/Hooka cd Hooka make </code></pre> <p>After that you will find the binary under the <code>build/</code> folder</p> <h1>Usage</h1> <blockquote> <p>Help panel</p> </blockquote> <pre><code> _ _ _ _ | | | | ___ ___ | | __ __ _ | | | |_| | / _ \ / _ \ | |/ / / _` | | | | _ | | (_) | | (_) | | &lt; | (_| | |_| |_| |_| \___/ \___/ |_|\_\ \__,_| (_) Usage of Hooka: REQUIRED: -i, --input string payload to inject in raw format, as PE, as DLL or from a URL -o, --output string name of output file (i.e. loader.exe) -f, --format string format of the payload to generate (available: exe, dll) (default exe) EXECUTION: --proc string process to spawn (in suspended state) when needed for given execution technique (default notepad.exe) --exec string technique used to load shellcode (default "SuspendedProcess"): SuspendedProcess ProcessHollowing NtCreateThreadEx EtwpCreateEtwThread NtQueueApcThreadEx No-RWX AUXILIARY: -a, --arch string architecture of the loader to generate (default amd64) -c, --cert string certificate to sign generated loader with (i.e. cert.pfx) -d, --domain string domain used to sign loader (i.e. www.microsoft.com) ENCODING: --enc string encrypts shellcode using given algorithm (available: aes, 3des, rc4, xor) (default none) --sgn use Shikata Ga Nai to encode generated loader (it must be installed on path) --strings obfuscate strings using Caesar cipher EVASION: --unhook string unhooking technique to use (available: full, peruns) --sandbox enable sandbox evasion --no-amsi don't patch AMSI --no-etw don't patch ETW --hashing use hashes to retrieve function pointers --acg enable ACG Guard to prevent AV/EDR from modifying existing executable code --blockdlls prevent non-Microsoft signed DLLs from injecting in child processes --phantom suspend EventLog threads using Phant0m technique. High privileges needed, otherwise loader skips this step --sleep delay shellcode execution using a custom sleep function EXTRA: --calc use a calc.exe shellcode to test loader capabilities (don't provide input file) --compress compress generated loader using Golang compiler and UPX if it's installed -r, --rand use a random set of parameters to create a random loader (just for testing purposes) -v, --verbose enable verbose to print extra information -h, --help print help panel Examples: hooka -i shellcode.bin -o loader.exe hooka -i http://192.168.1.126/shellcode.bin -o loader.exe hooka -i shellcode.bin -o loader.exe --exec NtCreateThreadEx --unhook full --sleep 60 --acg hooka -i shellcode.bin -o loader.dll --domain www.domain.com --enc aes --verbose </code></pre> <blockquote> <p>Generate a simple EXE loader</p> </blockquote> <pre><code class="language-sh">$ hooka_linux_amd64 -i shellcode.bin -o loader.exe </code></pre> <blockquote> <p>Generate a DLL loader</p> </blockquote> <pre><code class="language-sh">$ hooka_linux_amd64 -i shellcode.bin -o loader.dll -f dll </code></pre> <blockquote> <p>Use custom config (various examples)</p> </blockquote> <pre><code class="language-sh">$ hooka_linux_amd64 -i shellcode.bin -o loader.exe --hashing --agc --sleep --verbose $ hooka_linux_amd64 -i shellcode.bin -o loader.exe --exec ProcessHollowing --sgn --strings --blockdlls $ hooka_linux_amd64 -i http://xx.xx.xx.xx/shellcode.bin --sandbox --sleep --domain www.microsoft.com --verbose </code></pre> <h1>Demo</h1> <img src="https://raw.githubusercontent.com/D3Ext/Hooka/main/assets/demo1.png"> <img src="https://raw.githubusercontent.com/D3Ext/Hooka/main/assets/demo2.png"> <h1>TODO</h1> <ul> <li>Add direct and indirect syscall</li> <li>Add Chacha20 cypher to encrypt shellcode</li> <li>More OPSEC features</li> <li>General improvement</li> </ul> <h1>Library</h1> <p>The official Golang package has most of the already mentioned features and some others. To make use of it, see <a href="https://github.com/D3Ext/Hooka/tree/main/examples">here</a> and <a href="https://github.com/D3Ext/Hooka/tree/main/pkg/hooka">here</a></p> <h1>References</h1> <p>You can take a look at some of the mentioned techniques here:</p> <pre><code>https://github.com/C-Sto/BananaPhone https://github.com/timwhitez/Doge-Gabh https://github.com/Ne0nd0g/go-shellcode https://github.com/optiv/Freeze https://github.com/f1zm0/acheron https://github.com/Enelg52/OffensiveGo https://github.com/trickster0/TartarusGate https://github.com/Kara-4search/HookDetection_CSharp https://github.com/RedLectroid/APIunhooker https://github.com/plackyhacker/Peruns-Fart https://github.com/rasta-mouse/TikiTorch https://github.com/phra/PEzor https://github.com/S1ckB0y1337/Cobalt-Strike-CheatSheet https://github.com/chvancooten/maldev-for-dummies https://blog.sektor7.net/#!res/2021/perunsfart.md https://teamhydra.blog/2020/09/18/implementing-direct-syscalls-using-hells-gate/ https://www.ired.team/offensive-security/defense-evasion/detecting-hooked-syscall-functions#checking-for-hooks https://www.ired.team/offensive-security/defense-evasion/how-to-unhook-a-dll-using-c++ https://www.ired.team/offensive-security/defense-evasion/retrieving-ntdll-syscall-stubs-at-run-time https://www.ired.team/offensive-security/defense-evasion/windows-api-hashing-in-malware https://winternl.com/detecting-manual-syscalls-from-user-mode/ </code></pre> <h1>Disclaimer</h1> <p>Use this project under your own responsability! The author is not responsible of any bad usage of the project.</p> <h1>License</h1> <p>This project is under <a href="https://github.com/D3Ext/Hooka/raw/main/LICENSE">MIT</a> license</p> <p>Copyright © 2024, <em>D3Ext</em></p> + \ No newline at end of file diff --git a/golo/daily/index.xml b/golo/daily/index.xml index 550d1762b90..0e6bc0994fa 100644 --- a/golo/daily/index.xml +++ b/golo/daily/index.xml @@ -1,7 +1,7 @@ GitHub Golo Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:34Z + 2024-12-10T01:31:12Z Daily Trending of Golo in GitHub \ No newline at end of file diff --git a/gosu/daily/index.xml b/gosu/daily/index.xml index 51d8c4c8117..07cf76b869d 100644 --- a/gosu/daily/index.xml +++ b/gosu/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gosu Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:35Z + 2024-12-10T01:31:12Z Daily Trending of Gosu in GitHub \ No newline at end of file diff --git a/grace/daily/index.xml b/grace/daily/index.xml index 8390d7a121b..7565e1878b4 100644 --- a/grace/daily/index.xml +++ b/grace/daily/index.xml @@ -1,7 +1,7 @@ GitHub Grace Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:35Z + 2024-12-10T01:31:12Z Daily Trending of Grace in GitHub \ No newline at end of file diff --git a/gradle/daily/index.xml b/gradle/daily/index.xml index db773d1d304..199f313ba6b 100644 --- a/gradle/daily/index.xml +++ b/gradle/daily/index.xml @@ -1,7 +1,7 @@ GitHub Gradle Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:35Z + 2024-12-10T01:31:11Z Daily Trending of Gradle in GitHub \ No newline at end of file diff --git a/grammatical-framework/daily/index.xml b/grammatical-framework/daily/index.xml index 20feedd2149..1740162e667 100644 --- a/grammatical-framework/daily/index.xml +++ b/grammatical-framework/daily/index.xml @@ -1,7 +1,7 @@ GitHub Grammatical Framework Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:37Z + 2024-12-10T01:31:13Z Daily Trending of Grammatical Framework in GitHub \ No newline at end of file diff --git a/graph-modeling-language/daily/index.xml b/graph-modeling-language/daily/index.xml index 4c96a680747..d6d82ee1455 100644 --- a/graph-modeling-language/daily/index.xml +++ b/graph-modeling-language/daily/index.xml @@ -1,7 +1,7 @@ GitHub Graph Modeling Language Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:37Z + 2024-12-10T01:31:13Z Daily Trending of Graph Modeling Language in GitHub \ No newline at end of file diff --git a/graphql/daily/index.xml b/graphql/daily/index.xml index 5b614328058..ebb3d818acb 100644 --- a/graphql/daily/index.xml +++ b/graphql/daily/index.xml @@ -1,7 +1,7 @@ GitHub GraphQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:36Z + 2024-12-10T01:31:14Z Daily Trending of GraphQL in GitHub \ No newline at end of file diff --git a/graphviz-(dot)/daily/index.xml b/graphviz-(dot)/daily/index.xml index 5dd3ce3d8dc..999ea80e65f 100644 --- a/graphviz-(dot)/daily/index.xml +++ b/graphviz-(dot)/daily/index.xml @@ -1,7 +1,7 @@ GitHub Graphviz (DOT) Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:38Z + 2024-12-10T01:31:15Z Daily Trending of Graphviz (DOT) in GitHub \ No newline at end of file diff --git a/groovy-server-pages/daily/index.xml b/groovy-server-pages/daily/index.xml index d75c3b773aa..94903849d07 100644 --- a/groovy-server-pages/daily/index.xml +++ b/groovy-server-pages/daily/index.xml @@ -1,7 +1,7 @@ GitHub Groovy Server Pages Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:38Z + 2024-12-10T01:31:15Z Daily Trending of Groovy Server Pages in GitHub \ No newline at end of file diff --git a/groovy/daily/index.xml b/groovy/daily/index.xml index e9b58644740..8065ef0b52f 100644 --- a/groovy/daily/index.xml +++ b/groovy/daily/index.xml @@ -1,7 +1,7 @@ GitHub Groovy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:39Z + 2024-12-10T01:31:14Z Daily Trending of Groovy in GitHub \ No newline at end of file diff --git a/gsc/daily/index.xml b/gsc/daily/index.xml index 98e4c76c10c..99cba08386a 100644 --- a/gsc/daily/index.xml +++ b/gsc/daily/index.xml @@ -1,7 +1,7 @@ GitHub GSC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:38Z + 2024-12-10T01:31:15Z Daily Trending of GSC in GitHub \ No newline at end of file diff --git a/hack/daily/index.xml b/hack/daily/index.xml index 0ea674d7c19..604cc6721a6 100644 --- a/hack/daily/index.xml +++ b/hack/daily/index.xml @@ -1,7 +1,7 @@ GitHub Hack Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:40Z + 2024-12-10T01:31:16Z Daily Trending of Hack in GitHub \ No newline at end of file diff --git a/haml/daily/index.xml b/haml/daily/index.xml index d13a4af578f..1556982bce1 100644 --- a/haml/daily/index.xml +++ b/haml/daily/index.xml @@ -1,7 +1,7 @@ GitHub Haml Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:39Z + 2024-12-10T01:31:16Z Daily Trending of Haml in GitHub \ No newline at end of file diff --git a/handlebars/daily/index.xml b/handlebars/daily/index.xml index 15554b2028d..8ea6fc14eab 100644 --- a/handlebars/daily/index.xml +++ b/handlebars/daily/index.xml @@ -1,7 +1,7 @@ GitHub Handlebars Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:41Z + 2024-12-10T01:31:17Z Daily Trending of Handlebars in GitHub \ No newline at end of file diff --git a/haproxy/daily/index.xml b/haproxy/daily/index.xml index 30462b23425..88fe0696a06 100644 --- a/haproxy/daily/index.xml +++ b/haproxy/daily/index.xml @@ -1,7 +1,7 @@ GitHub HAProxy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:40Z + 2024-12-10T01:31:16Z Daily Trending of HAProxy in GitHub \ No newline at end of file diff --git a/harbour/daily/index.xml b/harbour/daily/index.xml index d9fce8288bb..a45c02696c2 100644 --- a/harbour/daily/index.xml +++ b/harbour/daily/index.xml @@ -1,7 +1,7 @@ GitHub Harbour Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:41Z + 2024-12-10T01:31:17Z Daily Trending of Harbour in GitHub \ No newline at end of file diff --git a/haskell/daily/index.xml b/haskell/daily/index.xml index 6df04ea1402..88ceb50db9a 100644 --- a/haskell/daily/index.xml +++ b/haskell/daily/index.xml @@ -1,7 +1,7 @@ GitHub Haskell Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:44Z + 2024-12-10T01:31:19Z Daily Trending of Haskell in GitHub \ No newline at end of file diff --git a/haxe/daily/index.xml b/haxe/daily/index.xml index 51beaa51376..6680addbfc4 100644 --- a/haxe/daily/index.xml +++ b/haxe/daily/index.xml @@ -1,7 +1,14 @@ GitHub Haxe Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:42Z + 2024-12-10T01:31:19Z Daily Trending of Haxe in GitHub + + CodenameCrew/CodenameEngine + 2024-12-10T01:31:19Z + tag:github.com,2024-12-10:/CodenameCrew/CodenameEngine + + <p>awesome fnf engine :D</p><hr><h1>Friday Night Funkin' - Codename Engine (WIP)</h1> <h2>PLEASE NOTE - THIS IS STILL IN A BETA STATE</h2> <h3>Mods created with beta versions of Codename may not be compatible with the release version</h3> <p>Known issues in the beta:</p> <ul> <li>Some options are missing</li> </ul> <p>Build instructions are below. Press TAB on the main menu to switch mods.</p> <p>Also, the command <code>.\cne test</code> uses the source assets folder instead of the export one for easier development (Although you can still use <code>lime test windows</code> normally).</p> <h2>Codename Engine</h2> <p>Codename Engine is a new Friday Night Funkin' Engine aimed at simplifying modding, along with extensiblity and ease of use.<br></p> <h3>Before making issues or need help with something, check our website <a href="https://codename-engine.com/">HERE</a> (it contains a wiki of how to mod with EXAMPLES, an api, lists of mods made with Codename Engine and more)!!!</h3> <h4>The Engine includes many new features, as seen <a href="https://raw.githubusercontent.com/CodenameCrew/CodenameEngine/main/FEATURES.md">here</a><br></h4> <h4>Wanna see the new features added in the most recent update? Click <a href="https://raw.githubusercontent.com/CodenameCrew/CodenameEngine/main/PATCHNOTES.md">here</a><br></h4> <h2>How to download</h2> <p>Latest builds for the engine can be found in the <a href="https://github.com/YoshiCrafter29/CodenameEngine/actions">Actions</a> tab.<br> In the future (when the engine won't be a WIP anymore) we're gonna also publish the engine on platforms like Gamebanana; stay tuned!</p> <details> <summary><h2>How to build</h2></summary> <blockquote> <p><strong>Open the instructions for your platform</strong></p> </blockquote> <details> <summary>Windows</summary> <h5>Tested on Windows 10 21H2</h5> <ol> <li>Install <a href="https://haxe.org/download/version/4.2.5/">version 4.2.5 of Haxe</a>.</li> <li>Download and install <a href="https://git-scm.com/download/win"><code>git-scm</code></a>. <ul> <li>Leave all installation options as default.</li> </ul> </li> <li>Run <code>update.bat</code> using cmd or double-clicking it, and wait for the libraries to install.</li> <li>Once the libraries are installed, run <code>haxelib run lime test windows</code> to compile and launch the game (may take a long time) <ul> <li>ℹ You can run <code>haxelib run lime setup</code> to make the lime command global, allowing you to execute <code>lime test windows</code> directly.</li> </ul> </li> </ol> </details> <details> <summary>Linux</summary> <h5>Requires testing</h5> <ol> <li>Install <a href="https://haxe.org/download/version/4.2.5/">version 4.2.5 of Haxe</a>.</li> <li>Install <code>g++</code>, if not present already.</li> <li>Download and install <a href="https://git-scm.com/download/linux"><code>git-scm</code></a>.</li> <li>Open a terminal in the Codename Engine source folder, and run <code>update.sh</code>.</li> <li>Once the libraries are installed, run <code>haxelib run lime test linux</code> to compile and launch the game (may take a long time) <ul> <li>ℹ You can run <code>haxelib run lime setup</code> to make the lime command global, allowing you to execute <code>lime test linux</code> directly.</li> </ul> </li> </ol> </details> <details> <summary>MacOS</summary> <h5>Requires testing</h5> <ol> <li>Install <a href="https://haxe.org/download/version/4.2.5/">version 4.2.5 of Haxe</a>.</li> <li>Install <code>Xcode</code> to allow C++ app building.</li> <li>Download and install <a href="https://git-scm.com/download/mac"><code>git-scm</code></a>.</li> <li>Open a terminal in the Codename Engine source folder, and run <code>update.sh</code>.</li> <li>Once the libraries are installed, run <code>haxelib run lime test mac</code> to compile and launch the game (may take a long time) <ul> <li>ℹ You can run <code>haxelib run lime setup</code> to make the lime command global, allowing you to execute <code>lime test mac</code> directly.</li> </ul> </li> </ol> </details> </details> <details> <summary><h2>What can you do or not do</h2></summary> <h3>You can:</h3> <ul> <li>Download and play the engine with its mods and modpacks</li> <li>Mod and fork the engine (without using it for illicit purposes)</li> <li>Contribute to the engine (for example through <em>Pull Requests</em>, <em>Issues</em>, etc)</li> <li>Create a sub engine with Codename Engine as <strong>TEMPLATE</strong> with <strong>CREDITS</strong> (for example leaving the <em>credits menu submenu with the GitHub contributors</em> and putting the <em><a href="https://github.com/CodenameCrew">main devs</a></em> in a <em>README</em> specifying that it's a <em>sub engine from Codename Engine</em>)</li> <li>Release excutable mods that use Codename Engine as source (Specifing that uses Codename Engine by for example the same way written above this)</li> <li>Release modpacks</li> </ul> <h3>You can't:</h3> <ul> <li>Create a <em>side/new/etc</em> engine (or mod that doesn't use Codename Engine) using Codename Engine's code</li> <li>Steal code from Codename Engine for another different project that is not Codename Engine related (Codename Engine mods excluded) without properly crediting</li> <li>Release the entire Codename Engine on platforms (Mods that use Codename Engine as source are fine, if it's specified even better)</li> </ul> <h4><em>If you need more info or feel like asking to do something which is not listed here, ask us directly on our discord (linked in the wiki)!</em></h4> </details> <details> <summary><h2>Credits</h2></summary> <ul> <li>Credits to <a href="https://twitter.com/Ne_Eo_Twitch">Ne_Eo</a> and the <a href="https://github.com/lunarcleint/3D-HaxeFlixel">3D-HaxeFlixel</a> repository for Away3D Flixel support</li> <li>Credits to the <a href="https://github.com/Dot-Stuff/flxanimate">FlxAnimate</a> team for the Animate Atlas support</li> <li>Credits to Smokey555 for the backup Animate Atlas to spritesheet code</li> <li>Credits to MAJigsaw77 for <a href="https://github.com/MAJigsaw77/hxvlc">hxvlc</a> (video cutscene/mp4 support) and <a href="https://github.com/MAJigsaw77/hxdiscord_rpc">hxdiscord_rpc</a> (discord rpc integration)</li> </ul> </details> + \ No newline at end of file diff --git a/hcl/daily/index.xml b/hcl/daily/index.xml index 8665ff67364..16bf133b642 100644 --- a/hcl/daily/index.xml +++ b/hcl/daily/index.xml @@ -1,14 +1,7 @@ GitHub HCL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:50Z + 2024-12-10T01:31:24Z Daily Trending of HCL in GitHub - - unfunco/terraform-aws-oidc-github - 2024-12-09T01:31:50Z - tag:github.com,2024-12-09:/unfunco/terraform-aws-oidc-github - - <p>Terraform module to configure GitHub Actions as an IAM OIDC identity provider in AWS.</p><hr> - \ No newline at end of file diff --git a/hiveql/daily/index.xml b/hiveql/daily/index.xml index 4fd833fd0f8..fe63606feaa 100644 --- a/hiveql/daily/index.xml +++ b/hiveql/daily/index.xml @@ -1,7 +1,7 @@ GitHub HiveQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:48Z + 2024-12-10T01:31:23Z Daily Trending of HiveQL in GitHub \ No newline at end of file diff --git a/hlsl/daily/index.xml b/hlsl/daily/index.xml index 950b10038da..814038d51df 100644 --- a/hlsl/daily/index.xml +++ b/hlsl/daily/index.xml @@ -1,7 +1,7 @@ GitHub HLSL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:49Z + 2024-12-10T01:31:23Z Daily Trending of HLSL in GitHub \ No newline at end of file diff --git a/holyc/daily/index.xml b/holyc/daily/index.xml index e5127275572..f799fa7320e 100644 --- a/holyc/daily/index.xml +++ b/holyc/daily/index.xml @@ -1,7 +1,7 @@ GitHub HolyC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:51Z + 2024-12-10T01:31:25Z Daily Trending of HolyC in GitHub \ No newline at end of file diff --git a/hoon/daily/index.xml b/hoon/daily/index.xml index c48960ad35b..133e68aff82 100644 --- a/hoon/daily/index.xml +++ b/hoon/daily/index.xml @@ -1,7 +1,7 @@ GitHub hoon Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:50Z + 2024-12-10T01:31:25Z Daily Trending of hoon in GitHub \ No newline at end of file diff --git a/html+ecr/daily/index.xml b/html+ecr/daily/index.xml index 7d31ddd557d..efaa8f8a08f 100644 --- a/html+ecr/daily/index.xml +++ b/html+ecr/daily/index.xml @@ -1,7 +1,7 @@ GitHub HTML+ECR Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:58Z + 2024-12-10T01:31:34Z Daily Trending of HTML+ECR in GitHub \ No newline at end of file diff --git a/html+eex/daily/index.xml b/html+eex/daily/index.xml index 4edba69feaf..6bddc873ad0 100644 --- a/html+eex/daily/index.xml +++ b/html+eex/daily/index.xml @@ -1,7 +1,7 @@ GitHub HTML+EEX Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:57Z + 2024-12-10T01:31:35Z Daily Trending of HTML+EEX in GitHub \ No newline at end of file diff --git a/html+erb/daily/index.xml b/html+erb/daily/index.xml index 9ec676bbc16..1644272d5c4 100644 --- a/html+erb/daily/index.xml +++ b/html+erb/daily/index.xml @@ -1,7 +1,7 @@ GitHub HTML+ERB Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:58Z + 2024-12-10T01:31:35Z Daily Trending of HTML+ERB in GitHub \ No newline at end of file diff --git a/html+php/daily/index.xml b/html+php/daily/index.xml index 6445920f88f..02ed0346bf3 100644 --- a/html+php/daily/index.xml +++ b/html+php/daily/index.xml @@ -1,7 +1,7 @@ GitHub HTML+PHP Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:59Z + 2024-12-10T01:31:36Z Daily Trending of HTML+PHP in GitHub \ No newline at end of file diff --git a/html+razor/daily/index.xml b/html+razor/daily/index.xml index 2506e2d8a15..e357ae58884 100644 --- a/html+razor/daily/index.xml +++ b/html+razor/daily/index.xml @@ -1,7 +1,7 @@ GitHub HTML+Razor Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:59Z + 2024-12-10T01:31:36Z Daily Trending of HTML+Razor in GitHub \ No newline at end of file diff --git a/html/daily/index.xml b/html/daily/index.xml index 9312969c239..b6d8cec10bd 100644 --- a/html/daily/index.xml +++ b/html/daily/index.xml @@ -1,7 +1,7 @@ GitHub HTML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:52Z + 2024-12-10T01:31:31Z Daily Trending of HTML in GitHub \ No newline at end of file diff --git a/http/daily/index.xml b/http/daily/index.xml index ce03d428578..268212382f7 100644 --- a/http/daily/index.xml +++ b/http/daily/index.xml @@ -1,7 +1,7 @@ GitHub HTTP Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:00Z + 2024-12-10T01:31:37Z Daily Trending of HTTP in GitHub \ No newline at end of file diff --git a/hxml/daily/index.xml b/hxml/daily/index.xml index fa77e66d0c1..2547d969480 100644 --- a/hxml/daily/index.xml +++ b/hxml/daily/index.xml @@ -1,7 +1,7 @@ GitHub HXML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:00Z + 2024-12-10T01:31:36Z Daily Trending of HXML in GitHub \ No newline at end of file diff --git a/hy/daily/index.xml b/hy/daily/index.xml index 3fe5b825bee..54bf2d92a5f 100644 --- a/hy/daily/index.xml +++ b/hy/daily/index.xml @@ -1,7 +1,7 @@ GitHub Hy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:02Z + 2024-12-10T01:31:37Z Daily Trending of Hy in GitHub \ No newline at end of file diff --git a/hyphy/daily/index.xml b/hyphy/daily/index.xml index 1c57daa8eb9..d88dc2a523b 100644 --- a/hyphy/daily/index.xml +++ b/hyphy/daily/index.xml @@ -1,7 +1,7 @@ GitHub HyPhy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:01Z + 2024-12-10T01:31:38Z Daily Trending of HyPhy in GitHub \ No newline at end of file diff --git a/idl/daily/index.xml b/idl/daily/index.xml index a51e081a16e..1e7afb6aab4 100644 --- a/idl/daily/index.xml +++ b/idl/daily/index.xml @@ -1,7 +1,7 @@ GitHub IDL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:01Z + 2024-12-10T01:31:37Z Daily Trending of IDL in GitHub \ No newline at end of file diff --git a/idris/daily/index.xml b/idris/daily/index.xml index 347eafe4706..19122a1c5ed 100644 --- a/idris/daily/index.xml +++ b/idris/daily/index.xml @@ -1,7 +1,7 @@ GitHub Idris Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:02Z + 2024-12-10T01:31:39Z Daily Trending of Idris in GitHub \ No newline at end of file diff --git a/ignore-list/daily/index.xml b/ignore-list/daily/index.xml index 2cc0c9000f0..14b6d045bf2 100644 --- a/ignore-list/daily/index.xml +++ b/ignore-list/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ignore List Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:03Z + 2024-12-10T01:31:39Z Daily Trending of Ignore List in GitHub \ No newline at end of file diff --git a/igor-pro/daily/index.xml b/igor-pro/daily/index.xml index 67ddc3a8f88..af61cc11303 100644 --- a/igor-pro/daily/index.xml +++ b/igor-pro/daily/index.xml @@ -1,7 +1,7 @@ GitHub IGOR Pro Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:03Z + 2024-12-10T01:31:39Z Daily Trending of IGOR Pro in GitHub \ No newline at end of file diff --git a/imagej-macro/daily/index.xml b/imagej-macro/daily/index.xml index 675f2ca1b2d..17cebc61e1e 100644 --- a/imagej-macro/daily/index.xml +++ b/imagej-macro/daily/index.xml @@ -1,7 +1,7 @@ GitHub ImageJ Macro Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:03Z + 2024-12-10T01:31:40Z Daily Trending of ImageJ Macro in GitHub \ No newline at end of file diff --git a/inform-7/daily/index.xml b/inform-7/daily/index.xml index 644b143454a..21a2c324c2c 100644 --- a/inform-7/daily/index.xml +++ b/inform-7/daily/index.xml @@ -1,7 +1,7 @@ GitHub Inform 7 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:05Z + 2024-12-10T01:31:41Z Daily Trending of Inform 7 in GitHub \ No newline at end of file diff --git a/ini/daily/index.xml b/ini/daily/index.xml index 85e5f95c1d3..125b4402640 100644 --- a/ini/daily/index.xml +++ b/ini/daily/index.xml @@ -1,7 +1,7 @@ GitHub INI Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:04Z + 2024-12-10T01:31:41Z Daily Trending of INI in GitHub \ No newline at end of file diff --git a/inno-setup/daily/index.xml b/inno-setup/daily/index.xml index 0eba1efb728..1f82b454dc0 100644 --- a/inno-setup/daily/index.xml +++ b/inno-setup/daily/index.xml @@ -1,7 +1,7 @@ GitHub Inno Setup Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:07Z + 2024-12-10T01:31:43Z Daily Trending of Inno Setup in GitHub \ No newline at end of file diff --git a/io/daily/index.xml b/io/daily/index.xml index d2f353a1022..7e0108269de 100644 --- a/io/daily/index.xml +++ b/io/daily/index.xml @@ -1,7 +1,7 @@ GitHub Io Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:06Z + 2024-12-10T01:31:42Z Daily Trending of Io in GitHub \ No newline at end of file diff --git a/ioke/daily/index.xml b/ioke/daily/index.xml index 79d4b0884e9..6ec1b64df69 100644 --- a/ioke/daily/index.xml +++ b/ioke/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ioke Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:06Z + 2024-12-10T01:31:42Z Daily Trending of Ioke in GitHub \ No newline at end of file diff --git a/irc-log/daily/index.xml b/irc-log/daily/index.xml index 96612c3e025..742d36b3fb9 100644 --- a/irc-log/daily/index.xml +++ b/irc-log/daily/index.xml @@ -1,7 +1,7 @@ GitHub IRC log Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:06Z + 2024-12-10T01:31:42Z Daily Trending of IRC log in GitHub \ No newline at end of file diff --git a/isabelle-root/daily/index.xml b/isabelle-root/daily/index.xml index 53e3020df63..9fa3310c781 100644 --- a/isabelle-root/daily/index.xml +++ b/isabelle-root/daily/index.xml @@ -1,7 +1,7 @@ GitHub Isabelle ROOT Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:08Z + 2024-12-10T01:31:44Z Daily Trending of Isabelle ROOT in GitHub \ No newline at end of file diff --git a/isabelle/daily/index.xml b/isabelle/daily/index.xml index 1b051dd45bf..9b76e5b057e 100644 --- a/isabelle/daily/index.xml +++ b/isabelle/daily/index.xml @@ -1,7 +1,7 @@ GitHub Isabelle Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:08Z + 2024-12-10T01:31:44Z Daily Trending of Isabelle in GitHub \ No newline at end of file diff --git a/j/daily/index.xml b/j/daily/index.xml index e71d34f4242..62da25631e8 100644 --- a/j/daily/index.xml +++ b/j/daily/index.xml @@ -1,7 +1,7 @@ GitHub J Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:08Z + 2024-12-10T01:31:43Z Daily Trending of J in GitHub \ No newline at end of file diff --git a/janet/daily/index.xml b/janet/daily/index.xml index 5e0c7560197..a211968a34e 100644 --- a/janet/daily/index.xml +++ b/janet/daily/index.xml @@ -1,7 +1,7 @@ GitHub Janet Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:07Z + 2024-12-10T01:31:44Z Daily Trending of Janet in GitHub \ No newline at end of file diff --git a/jar-manifest/daily/index.xml b/jar-manifest/daily/index.xml index 42fe32b0f3e..2923f6455a0 100644 --- a/jar-manifest/daily/index.xml +++ b/jar-manifest/daily/index.xml @@ -1,7 +1,7 @@ GitHub JAR Manifest Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:10Z + 2024-12-10T01:31:45Z Daily Trending of JAR Manifest in GitHub \ No newline at end of file diff --git a/jasmin/daily/index.xml b/jasmin/daily/index.xml index 52274976327..df560edbcf4 100644 --- a/jasmin/daily/index.xml +++ b/jasmin/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jasmin Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:09Z + 2024-12-10T01:31:46Z Daily Trending of Jasmin in GitHub \ No newline at end of file diff --git a/java-properties/daily/index.xml b/java-properties/daily/index.xml index 038d18f2a63..d5907aec17a 100644 --- a/java-properties/daily/index.xml +++ b/java-properties/daily/index.xml @@ -1,7 +1,7 @@ GitHub Java Properties Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:09Z + 2024-12-10T01:31:45Z Daily Trending of Java Properties in GitHub \ No newline at end of file diff --git a/java-server-pages/daily/index.xml b/java-server-pages/daily/index.xml index b0d35b274fe..1518d4f2329 100644 --- a/java-server-pages/daily/index.xml +++ b/java-server-pages/daily/index.xml @@ -1,7 +1,7 @@ GitHub Java Server Pages Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:16Z + 2024-12-10T01:31:50Z Daily Trending of Java Server Pages in GitHub \ No newline at end of file diff --git a/java/daily/index.xml b/java/daily/index.xml index af70cae25d1..0419083592d 100644 --- a/java/daily/index.xml +++ b/java/daily/index.xml @@ -1,7 +1,7 @@ GitHub Java Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:11Z + 2024-12-10T01:31:47Z Daily Trending of Java in GitHub \ No newline at end of file diff --git a/javascript+erb/daily/index.xml b/javascript+erb/daily/index.xml index 7a32d916e72..fb33cdf9b8e 100644 --- a/javascript+erb/daily/index.xml +++ b/javascript+erb/daily/index.xml @@ -1,7 +1,7 @@ GitHub JavaScript+ERB Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:16Z + 2024-12-10T01:31:50Z Daily Trending of JavaScript+ERB in GitHub \ No newline at end of file diff --git a/javascript/daily/index.xml b/javascript/daily/index.xml index cfea4f755ee..6af7d28dabc 100644 --- a/javascript/daily/index.xml +++ b/javascript/daily/index.xml @@ -1,7 +1,7 @@ GitHub JavaScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:18Z + 2024-12-10T01:31:51Z Daily Trending of JavaScript in GitHub \ No newline at end of file diff --git a/jest-snapshot/daily/index.xml b/jest-snapshot/daily/index.xml index 19c1fd206e9..5e14431c955 100644 --- a/jest-snapshot/daily/index.xml +++ b/jest-snapshot/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jest Snapshot Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:24Z + 2024-12-10T01:31:55Z Daily Trending of Jest Snapshot in GitHub \ No newline at end of file diff --git a/jflex/daily/index.xml b/jflex/daily/index.xml index 0cbf60d8e7f..ae5b24ee74e 100644 --- a/jflex/daily/index.xml +++ b/jflex/daily/index.xml @@ -1,7 +1,7 @@ GitHub JFlex Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:23Z + 2024-12-10T01:31:55Z Daily Trending of JFlex in GitHub \ No newline at end of file diff --git a/jinja/daily/index.xml b/jinja/daily/index.xml index abab2fb01d4..f3156788605 100644 --- a/jinja/daily/index.xml +++ b/jinja/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jinja Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:31:58Z + 2024-12-10T01:31:35Z Daily Trending of Jinja in GitHub \ No newline at end of file diff --git a/jison-lex/daily/index.xml b/jison-lex/daily/index.xml index 98d1dc502dc..225bef135bd 100644 --- a/jison-lex/daily/index.xml +++ b/jison-lex/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jison Lex Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:25Z + 2024-12-10T01:31:56Z Daily Trending of Jison Lex in GitHub \ No newline at end of file diff --git a/jison/daily/index.xml b/jison/daily/index.xml index 3d9309f9fae..34bea98e526 100644 --- a/jison/daily/index.xml +++ b/jison/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jison Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:25Z + 2024-12-10T01:31:57Z Daily Trending of Jison in GitHub \ No newline at end of file diff --git a/jolie/daily/index.xml b/jolie/daily/index.xml index 48aed086c68..124eea4b771 100644 --- a/jolie/daily/index.xml +++ b/jolie/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jolie Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:26Z + 2024-12-10T01:31:56Z Daily Trending of Jolie in GitHub \ No newline at end of file diff --git a/jq/daily/index.xml b/jq/daily/index.xml index a294be52a50..4e4f6c2e4d9 100644 --- a/jq/daily/index.xml +++ b/jq/daily/index.xml @@ -1,7 +1,7 @@ GitHub jq Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:26Z + 2024-12-10T01:31:57Z Daily Trending of jq in GitHub \ No newline at end of file diff --git a/json-with-comments/daily/index.xml b/json-with-comments/daily/index.xml index 32b78a7cd35..9a84942b17f 100644 --- a/json-with-comments/daily/index.xml +++ b/json-with-comments/daily/index.xml @@ -1,7 +1,7 @@ GitHub JSON with Comments Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:27Z + 2024-12-10T01:31:58Z Daily Trending of JSON with Comments in GitHub \ No newline at end of file diff --git a/json/daily/index.xml b/json/daily/index.xml index 941bbfce343..521839e0f01 100644 --- a/json/daily/index.xml +++ b/json/daily/index.xml @@ -1,7 +1,7 @@ GitHub JSON Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:28Z + 2024-12-10T01:31:59Z Daily Trending of JSON in GitHub \ No newline at end of file diff --git a/json5/daily/index.xml b/json5/daily/index.xml index 5aecbf11001..20a382b438b 100644 --- a/json5/daily/index.xml +++ b/json5/daily/index.xml @@ -1,7 +1,7 @@ GitHub JSON5 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:27Z + 2024-12-10T01:31:58Z Daily Trending of JSON5 in GitHub \ No newline at end of file diff --git a/jsoniq/daily/index.xml b/jsoniq/daily/index.xml index 34610eacf37..30c3463369e 100644 --- a/jsoniq/daily/index.xml +++ b/jsoniq/daily/index.xml @@ -1,7 +1,7 @@ GitHub JSONiq Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:27Z + 2024-12-10T01:31:58Z Daily Trending of JSONiq in GitHub \ No newline at end of file diff --git a/jsonld/daily/index.xml b/jsonld/daily/index.xml index 638744ed46c..434d36700e8 100644 --- a/jsonld/daily/index.xml +++ b/jsonld/daily/index.xml @@ -1,7 +1,7 @@ GitHub JSONLD Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:28Z + 2024-12-10T01:32:00Z Daily Trending of JSONLD in GitHub \ No newline at end of file diff --git a/jsonnet/daily/index.xml b/jsonnet/daily/index.xml index 345a164bbc1..0831ab63349 100644 --- a/jsonnet/daily/index.xml +++ b/jsonnet/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jsonnet Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:29Z + 2024-12-10T01:32:00Z Daily Trending of Jsonnet in GitHub \ No newline at end of file diff --git a/julia/daily/index.xml b/julia/daily/index.xml index 36b7985450a..9e9c65e6489 100644 --- a/julia/daily/index.xml +++ b/julia/daily/index.xml @@ -1,7 +1,7 @@ GitHub Julia Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:30Z + 2024-12-10T01:32:02Z Daily Trending of Julia in GitHub \ No newline at end of file diff --git a/jupyter-notebook/daily/index.xml b/jupyter-notebook/daily/index.xml index d1beec8d0ae..4be3057e29c 100644 --- a/jupyter-notebook/daily/index.xml +++ b/jupyter-notebook/daily/index.xml @@ -1,7 +1,7 @@ GitHub Jupyter Notebook Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:32Z + 2024-12-10T01:32:04Z Daily Trending of Jupyter Notebook in GitHub \ No newline at end of file diff --git a/kaitai-struct/daily/index.xml b/kaitai-struct/daily/index.xml index af2cc26f902..41bc4ad05fe 100644 --- a/kaitai-struct/daily/index.xml +++ b/kaitai-struct/daily/index.xml @@ -1,7 +1,7 @@ GitHub Kaitai Struct Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:31Z + 2024-12-10T01:32:03Z Daily Trending of Kaitai Struct in GitHub \ No newline at end of file diff --git a/kakounescript/daily/index.xml b/kakounescript/daily/index.xml index 78f2a12a7b4..62cfd5225d3 100644 --- a/kakounescript/daily/index.xml +++ b/kakounescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub KakouneScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:30Z + 2024-12-10T01:32:03Z Daily Trending of KakouneScript in GitHub \ No newline at end of file diff --git a/kicad-layout/daily/index.xml b/kicad-layout/daily/index.xml index 0f97a5a0388..ef549ee7089 100644 --- a/kicad-layout/daily/index.xml +++ b/kicad-layout/daily/index.xml @@ -1,7 +1,7 @@ GitHub KiCad Layout Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:35Z + 2024-12-10T01:32:07Z Daily Trending of KiCad Layout in GitHub \ No newline at end of file diff --git a/kicad-legacy-layout/daily/index.xml b/kicad-legacy-layout/daily/index.xml index 68238283e38..8d823bb147c 100644 --- a/kicad-legacy-layout/daily/index.xml +++ b/kicad-legacy-layout/daily/index.xml @@ -1,7 +1,7 @@ GitHub KiCad Legacy Layout Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:35Z + 2024-12-10T01:32:07Z Daily Trending of KiCad Legacy Layout in GitHub \ No newline at end of file diff --git a/kicad-schematic/daily/index.xml b/kicad-schematic/daily/index.xml index b4d2982166f..a2ba1a01bb4 100644 --- a/kicad-schematic/daily/index.xml +++ b/kicad-schematic/daily/index.xml @@ -1,7 +1,7 @@ GitHub KiCad Schematic Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:34Z + 2024-12-10T01:32:07Z Daily Trending of KiCad Schematic in GitHub \ No newline at end of file diff --git a/kit/daily/index.xml b/kit/daily/index.xml index 0303ff74534..610d4b52042 100644 --- a/kit/daily/index.xml +++ b/kit/daily/index.xml @@ -1,7 +1,7 @@ GitHub Kit Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:35Z + 2024-12-10T01:32:09Z Daily Trending of Kit in GitHub \ No newline at end of file diff --git a/kotlin/daily/index.xml b/kotlin/daily/index.xml index 837b8f9786f..6ab2137bf65 100644 --- a/kotlin/daily/index.xml +++ b/kotlin/daily/index.xml @@ -1,7 +1,7 @@ GitHub Kotlin Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:37Z + 2024-12-10T01:32:10Z Daily Trending of Kotlin in GitHub \ No newline at end of file diff --git a/krl/daily/index.xml b/krl/daily/index.xml index 4e1ff719875..1e10b0d50ec 100644 --- a/krl/daily/index.xml +++ b/krl/daily/index.xml @@ -1,7 +1,7 @@ GitHub KRL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:36Z + 2024-12-10T01:32:08Z Daily Trending of KRL in GitHub \ No newline at end of file diff --git a/kusto/daily/index.xml b/kusto/daily/index.xml index b3f0d28e3ca..2b7e4f4ebab 100644 --- a/kusto/daily/index.xml +++ b/kusto/daily/index.xml @@ -1,7 +1,7 @@ GitHub Kusto Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:40Z + 2024-12-10T01:32:13Z Daily Trending of Kusto in GitHub \ No newline at end of file diff --git a/kvlang/daily/index.xml b/kvlang/daily/index.xml index 20c15eff4a5..69649e06b1c 100644 --- a/kvlang/daily/index.xml +++ b/kvlang/daily/index.xml @@ -1,7 +1,7 @@ GitHub kvlang Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:39Z + 2024-12-10T01:32:13Z Daily Trending of kvlang in GitHub \ No newline at end of file diff --git a/labview/daily/index.xml b/labview/daily/index.xml index 246834fabd3..32eaabd2d33 100644 --- a/labview/daily/index.xml +++ b/labview/daily/index.xml @@ -1,7 +1,7 @@ GitHub LabVIEW Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:40Z + 2024-12-10T01:32:12Z Daily Trending of LabVIEW in GitHub \ No newline at end of file diff --git a/lark/daily/index.xml b/lark/daily/index.xml index 839f3db9981..983b468c88a 100644 --- a/lark/daily/index.xml +++ b/lark/daily/index.xml @@ -1,7 +1,7 @@ GitHub Lark Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:40Z + 2024-12-10T01:32:13Z Daily Trending of Lark in GitHub \ No newline at end of file diff --git a/lasso/daily/index.xml b/lasso/daily/index.xml index 7d581986277..ec165291d2b 100644 --- a/lasso/daily/index.xml +++ b/lasso/daily/index.xml @@ -1,7 +1,7 @@ GitHub Lasso Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:41Z + 2024-12-10T01:32:14Z Daily Trending of Lasso in GitHub \ No newline at end of file diff --git a/latte/daily/index.xml b/latte/daily/index.xml index 0eec6bdf186..71335210aee 100644 --- a/latte/daily/index.xml +++ b/latte/daily/index.xml @@ -1,7 +1,7 @@ GitHub Latte Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:41Z + 2024-12-10T01:32:14Z Daily Trending of Latte in GitHub \ No newline at end of file diff --git a/lean/daily/index.xml b/lean/daily/index.xml index c7f28e241ec..6dcc2f2643b 100644 --- a/lean/daily/index.xml +++ b/lean/daily/index.xml @@ -1,7 +1,7 @@ GitHub Lean Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:43Z + 2024-12-10T01:32:15Z Daily Trending of Lean in GitHub \ No newline at end of file diff --git a/less/daily/index.xml b/less/daily/index.xml index 929dc46d3d1..529f1493e5f 100644 --- a/less/daily/index.xml +++ b/less/daily/index.xml @@ -1,7 +1,7 @@ GitHub Less Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:44Z + 2024-12-10T01:32:17Z Daily Trending of Less in GitHub \ No newline at end of file diff --git a/lex/daily/index.xml b/lex/daily/index.xml index 58b7e740e41..8cecde957d4 100644 --- a/lex/daily/index.xml +++ b/lex/daily/index.xml @@ -1,7 +1,7 @@ GitHub Lex Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:44Z + 2024-12-10T01:32:16Z Daily Trending of Lex in GitHub \ No newline at end of file diff --git a/lfe/daily/index.xml b/lfe/daily/index.xml index 6f6baf3cad9..91bbdb852c6 100644 --- a/lfe/daily/index.xml +++ b/lfe/daily/index.xml @@ -1,7 +1,7 @@ GitHub LFE Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:44Z + 2024-12-10T01:32:16Z Daily Trending of LFE in GitHub \ No newline at end of file diff --git a/ligolang/daily/index.xml b/ligolang/daily/index.xml index ce233905763..13fcef8b451 100644 --- a/ligolang/daily/index.xml +++ b/ligolang/daily/index.xml @@ -1,7 +1,7 @@ GitHub LigoLANG Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:43Z + 2024-12-10T01:32:16Z Daily Trending of LigoLANG in GitHub \ No newline at end of file diff --git a/lilypond/daily/index.xml b/lilypond/daily/index.xml index c1e9b05a9a2..7d3cd7dfd02 100644 --- a/lilypond/daily/index.xml +++ b/lilypond/daily/index.xml @@ -1,7 +1,7 @@ GitHub LilyPond Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:46Z + 2024-12-10T01:32:18Z Daily Trending of LilyPond in GitHub \ No newline at end of file diff --git a/limbo/daily/index.xml b/limbo/daily/index.xml index 7c1ba450b6d..474c4a891c3 100644 --- a/limbo/daily/index.xml +++ b/limbo/daily/index.xml @@ -1,7 +1,7 @@ GitHub Limbo Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:45Z + 2024-12-10T01:32:17Z Daily Trending of Limbo in GitHub \ No newline at end of file diff --git a/linker-script/daily/index.xml b/linker-script/daily/index.xml index 56752cdb8ef..64a3016d695 100644 --- a/linker-script/daily/index.xml +++ b/linker-script/daily/index.xml @@ -1,7 +1,7 @@ GitHub Linker Script Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:46Z + 2024-12-10T01:32:18Z Daily Trending of Linker Script in GitHub \ No newline at end of file diff --git a/linux-kernel-module/daily/index.xml b/linux-kernel-module/daily/index.xml index cb27a038109..dba55bd9422 100644 --- a/linux-kernel-module/daily/index.xml +++ b/linux-kernel-module/daily/index.xml @@ -1,7 +1,7 @@ GitHub Linux Kernel Module Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:45Z + 2024-12-10T01:32:17Z Daily Trending of Linux Kernel Module in GitHub \ No newline at end of file diff --git a/liquid/daily/index.xml b/liquid/daily/index.xml index 1e22158ff9f..07b111fb4ea 100644 --- a/liquid/daily/index.xml +++ b/liquid/daily/index.xml @@ -1,7 +1,7 @@ GitHub Liquid Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:47Z + 2024-12-10T01:32:20Z Daily Trending of Liquid in GitHub \ No newline at end of file diff --git a/literate-agda/daily/index.xml b/literate-agda/daily/index.xml index 8edeec9c504..0677084695d 100644 --- a/literate-agda/daily/index.xml +++ b/literate-agda/daily/index.xml @@ -1,7 +1,7 @@ GitHub Literate Agda Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:48Z + 2024-12-10T01:32:19Z Daily Trending of Literate Agda in GitHub \ No newline at end of file diff --git a/literate-coffeescript/daily/index.xml b/literate-coffeescript/daily/index.xml index 84125f14715..8c761b27170 100644 --- a/literate-coffeescript/daily/index.xml +++ b/literate-coffeescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub Literate CoffeeScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:47Z + 2024-12-10T01:32:19Z Daily Trending of Literate CoffeeScript in GitHub \ No newline at end of file diff --git a/literate-haskell/daily/index.xml b/literate-haskell/daily/index.xml index c4e21940e1a..b5f3b0aa44f 100644 --- a/literate-haskell/daily/index.xml +++ b/literate-haskell/daily/index.xml @@ -1,7 +1,7 @@ GitHub Literate Haskell Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:47Z + 2024-12-10T01:32:19Z Daily Trending of Literate Haskell in GitHub \ No newline at end of file diff --git a/livescript/daily/index.xml b/livescript/daily/index.xml index ab887819177..1cb043af69e 100644 --- a/livescript/daily/index.xml +++ b/livescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub LiveScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:49Z + 2024-12-10T01:32:20Z Daily Trending of LiveScript in GitHub \ No newline at end of file diff --git a/llvm/daily/index.xml b/llvm/daily/index.xml index 770bfa4b4d3..63cc4fcda50 100644 --- a/llvm/daily/index.xml +++ b/llvm/daily/index.xml @@ -1,7 +1,7 @@ GitHub LLVM Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:51Z + 2024-12-10T01:32:23Z Daily Trending of LLVM in GitHub \ No newline at end of file diff --git a/logos/daily/index.xml b/logos/daily/index.xml index 4be6d18354b..6fc666a4bf6 100644 --- a/logos/daily/index.xml +++ b/logos/daily/index.xml @@ -1,7 +1,7 @@ GitHub Logos Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:49Z + 2024-12-10T01:32:21Z Daily Trending of Logos in GitHub \ No newline at end of file diff --git a/logtalk/daily/index.xml b/logtalk/daily/index.xml index 596dee5a2d2..4aa97f53693 100644 --- a/logtalk/daily/index.xml +++ b/logtalk/daily/index.xml @@ -1,7 +1,7 @@ GitHub Logtalk Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:51Z + 2024-12-10T01:32:23Z Daily Trending of Logtalk in GitHub \ No newline at end of file diff --git a/lolcode/daily/index.xml b/lolcode/daily/index.xml index f6d6ff6d9d5..13cd928a928 100644 --- a/lolcode/daily/index.xml +++ b/lolcode/daily/index.xml @@ -1,7 +1,7 @@ GitHub LOLCODE Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:52Z + 2024-12-10T01:32:24Z Daily Trending of LOLCODE in GitHub \ No newline at end of file diff --git a/lookml/daily/index.xml b/lookml/daily/index.xml index f28c078444d..e56fc11aa8e 100644 --- a/lookml/daily/index.xml +++ b/lookml/daily/index.xml @@ -1,7 +1,7 @@ GitHub LookML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:52Z + 2024-12-10T01:32:24Z Daily Trending of LookML in GitHub \ No newline at end of file diff --git a/loomscript/daily/index.xml b/loomscript/daily/index.xml index 25134cff19d..94bab787f6f 100644 --- a/loomscript/daily/index.xml +++ b/loomscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub LoomScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:52Z + 2024-12-10T01:32:24Z Daily Trending of LoomScript in GitHub \ No newline at end of file diff --git a/lsl/daily/index.xml b/lsl/daily/index.xml index 90391a359a5..1c4e8c2dad0 100644 --- a/lsl/daily/index.xml +++ b/lsl/daily/index.xml @@ -1,7 +1,7 @@ GitHub LSL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:54Z + 2024-12-10T01:32:25Z Daily Trending of LSL in GitHub \ No newline at end of file diff --git a/ltspice-symbol/daily/index.xml b/ltspice-symbol/daily/index.xml index 2730cbf1b35..7974d3b7755 100644 --- a/ltspice-symbol/daily/index.xml +++ b/ltspice-symbol/daily/index.xml @@ -1,7 +1,7 @@ GitHub LTspice Symbol Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:53Z + 2024-12-10T01:32:25Z Daily Trending of LTspice Symbol in GitHub \ No newline at end of file diff --git a/lua/daily/index.xml b/lua/daily/index.xml index 6c7e7dc8bcc..fee14aeeb87 100644 --- a/lua/daily/index.xml +++ b/lua/daily/index.xml @@ -1,7 +1,7 @@ GitHub Lua Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:56Z + 2024-12-10T01:32:26Z Daily Trending of Lua in GitHub \ No newline at end of file diff --git a/m/daily/index.xml b/m/daily/index.xml index 607b5c5d312..01c52b8a7d1 100644 --- a/m/daily/index.xml +++ b/m/daily/index.xml @@ -1,7 +1,7 @@ GitHub M Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:32:59Z + 2024-12-10T01:32:31Z Daily Trending of M in GitHub \ No newline at end of file diff --git a/m4/daily/index.xml b/m4/daily/index.xml index 2b14cbe484c..1adad361856 100644 --- a/m4/daily/index.xml +++ b/m4/daily/index.xml @@ -1,7 +1,7 @@ GitHub M4 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:00Z + 2024-12-10T01:32:31Z Daily Trending of M4 in GitHub \ No newline at end of file diff --git a/m4sugar/daily/index.xml b/m4sugar/daily/index.xml index 1160d13a488..7af59af6747 100644 --- a/m4sugar/daily/index.xml +++ b/m4sugar/daily/index.xml @@ -1,7 +1,7 @@ GitHub M4Sugar Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:00Z + 2024-12-10T01:32:30Z Daily Trending of M4Sugar in GitHub \ No newline at end of file diff --git a/macaulay2/daily/index.xml b/macaulay2/daily/index.xml index 7ae2fdb44eb..fa7f8aa9da2 100644 --- a/macaulay2/daily/index.xml +++ b/macaulay2/daily/index.xml @@ -1,7 +1,7 @@ GitHub Macaulay2 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:01Z + 2024-12-10T01:32:30Z Daily Trending of Macaulay2 in GitHub \ No newline at end of file diff --git a/makefile/daily/index.xml b/makefile/daily/index.xml deleted file mode 100644 index 1c5e932b190..00000000000 --- a/makefile/daily/index.xml +++ /dev/null @@ -1,7 +0,0 @@ - - GitHub Makefile Daily Trending - http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:02Z - Daily Trending of Makefile in GitHub - - \ No newline at end of file diff --git a/mako/daily/index.xml b/mako/daily/index.xml index b63abf5f182..a6d6eaab43d 100644 --- a/mako/daily/index.xml +++ b/mako/daily/index.xml @@ -1,7 +1,7 @@ GitHub Mako Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:01Z + 2024-12-10T01:32:32Z Daily Trending of Mako in GitHub \ No newline at end of file diff --git a/markdown/daily/index.xml b/markdown/daily/index.xml index f7a44f3b9a4..b11dddbb8c2 100644 --- a/markdown/daily/index.xml +++ b/markdown/daily/index.xml @@ -1,7 +1,7 @@ GitHub Markdown Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:10Z + 2024-12-10T01:32:41Z Daily Trending of Markdown in GitHub \ No newline at end of file diff --git a/marko/daily/index.xml b/marko/daily/index.xml index c1e62bc4d90..7b236d830ca 100644 --- a/marko/daily/index.xml +++ b/marko/daily/index.xml @@ -1,7 +1,7 @@ GitHub Marko Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:02Z + 2024-12-10T01:32:32Z Daily Trending of Marko in GitHub \ No newline at end of file diff --git a/mask/daily/index.xml b/mask/daily/index.xml index 68dc5b796ad..94fc93c98b4 100644 --- a/mask/daily/index.xml +++ b/mask/daily/index.xml @@ -1,7 +1,7 @@ GitHub Mask Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:11Z + 2024-12-10T01:35:05Z Daily Trending of Mask in GitHub \ No newline at end of file diff --git a/mathematica/daily/index.xml b/mathematica/daily/index.xml index dc5abbe04f2..40955628481 100644 --- a/mathematica/daily/index.xml +++ b/mathematica/daily/index.xml @@ -1,7 +1,7 @@ GitHub Mathematica Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:12Z + 2024-12-10T01:35:05Z Daily Trending of Mathematica in GitHub \ No newline at end of file diff --git a/matlab/daily/index.xml b/matlab/daily/index.xml index 2c850fe2ea1..6589da60328 100644 --- a/matlab/daily/index.xml +++ b/matlab/daily/index.xml @@ -1,7 +1,14 @@ GitHub MATLAB Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:12Z + 2024-12-10T01:35:06Z Daily Trending of MATLAB in GitHub + + pulseq/pulseq + 2024-12-10T01:35:06Z + tag:github.com,2024-12-10:/pulseq/pulseq + + <p>Open source framework for pulse sequences</p><hr> + \ No newline at end of file diff --git a/maven-pom/daily/index.xml b/maven-pom/daily/index.xml index 4da48567391..fa44564245b 100644 --- a/maven-pom/daily/index.xml +++ b/maven-pom/daily/index.xml @@ -1,7 +1,7 @@ GitHub Maven POM Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:11Z + 2024-12-10T01:35:05Z Daily Trending of Maven POM in GitHub \ No newline at end of file diff --git a/max/daily/index.xml b/max/daily/index.xml index 8d802e612df..af06da4b3bb 100644 --- a/max/daily/index.xml +++ b/max/daily/index.xml @@ -1,7 +1,7 @@ GitHub Max Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:12Z + 2024-12-10T01:35:07Z Daily Trending of Max in GitHub \ No newline at end of file diff --git a/maxscript/daily/index.xml b/maxscript/daily/index.xml index de2cf40a807..45e51525c28 100644 --- a/maxscript/daily/index.xml +++ b/maxscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub MAXScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:13Z + 2024-12-10T01:35:07Z Daily Trending of MAXScript in GitHub \ No newline at end of file diff --git a/mcfunction/daily/index.xml b/mcfunction/daily/index.xml index a75b57e6225..b4bf8d189c5 100644 --- a/mcfunction/daily/index.xml +++ b/mcfunction/daily/index.xml @@ -1,7 +1,7 @@ GitHub mcfunction Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:13Z + 2024-12-10T01:35:06Z Daily Trending of mcfunction in GitHub \ No newline at end of file diff --git a/mercury/daily/index.xml b/mercury/daily/index.xml index 46ea463bbd3..dd6d5c0fec8 100644 --- a/mercury/daily/index.xml +++ b/mercury/daily/index.xml @@ -1,7 +1,7 @@ GitHub Mercury Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:16Z + 2024-12-10T01:35:09Z Daily Trending of Mercury in GitHub \ No newline at end of file diff --git a/meson/daily/index.xml b/meson/daily/index.xml index c7f0522cd24..eee3f5915f8 100644 --- a/meson/daily/index.xml +++ b/meson/daily/index.xml @@ -1,7 +1,7 @@ GitHub Meson Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:16Z + 2024-12-10T01:35:10Z Daily Trending of Meson in GitHub \ No newline at end of file diff --git a/metal/daily/index.xml b/metal/daily/index.xml index c7473b82013..973114ecb84 100644 --- a/metal/daily/index.xml +++ b/metal/daily/index.xml @@ -1,7 +1,7 @@ GitHub Metal Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:17Z + 2024-12-10T01:35:12Z Daily Trending of Metal in GitHub \ No newline at end of file diff --git a/microsoft-developer-studio-project/daily/index.xml b/microsoft-developer-studio-project/daily/index.xml index a2aa1d006d9..79148bd961a 100644 --- a/microsoft-developer-studio-project/daily/index.xml +++ b/microsoft-developer-studio-project/daily/index.xml @@ -1,7 +1,7 @@ GitHub Microsoft Developer Studio Project Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:17Z + 2024-12-10T01:35:11Z Daily Trending of Microsoft Developer Studio Project in GitHub \ No newline at end of file diff --git a/microsoft-visual-studio-solution/daily/index.xml b/microsoft-visual-studio-solution/daily/index.xml index e458e3c8adc..e8188b261a1 100644 --- a/microsoft-visual-studio-solution/daily/index.xml +++ b/microsoft-visual-studio-solution/daily/index.xml @@ -1,7 +1,7 @@ GitHub Microsoft Visual Studio Solution Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:18Z + 2024-12-10T01:35:11Z Daily Trending of Microsoft Visual Studio Solution in GitHub \ No newline at end of file diff --git a/minid/daily/index.xml b/minid/daily/index.xml index d9b081bd481..4b1b52c6f52 100644 --- a/minid/daily/index.xml +++ b/minid/daily/index.xml @@ -1,7 +1,7 @@ GitHub MiniD Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:18Z + 2024-12-10T01:35:12Z Daily Trending of MiniD in GitHub \ No newline at end of file diff --git a/mint/daily/index.xml b/mint/daily/index.xml index b3d3676f3cd..b48286c8a3f 100644 --- a/mint/daily/index.xml +++ b/mint/daily/index.xml @@ -1,7 +1,7 @@ GitHub Mint Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:19Z + 2024-12-10T01:35:13Z Daily Trending of Mint in GitHub \ No newline at end of file diff --git a/mirah/daily/index.xml b/mirah/daily/index.xml index f969c1168b7..0b5057d8a2c 100644 --- a/mirah/daily/index.xml +++ b/mirah/daily/index.xml @@ -1,7 +1,7 @@ GitHub Mirah Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:20Z + 2024-12-10T01:35:13Z Daily Trending of Mirah in GitHub \ No newline at end of file diff --git a/mirc-script/daily/index.xml b/mirc-script/daily/index.xml index 98e073cbc03..9641aa9485e 100644 --- a/mirc-script/daily/index.xml +++ b/mirc-script/daily/index.xml @@ -1,7 +1,7 @@ GitHub mIRC Script Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:19Z + 2024-12-10T01:35:14Z Daily Trending of mIRC Script in GitHub \ No newline at end of file diff --git a/mlir/daily/index.xml b/mlir/daily/index.xml index 40e580cf5a7..6f856716a2d 100644 --- a/mlir/daily/index.xml +++ b/mlir/daily/index.xml @@ -1,7 +1,7 @@ GitHub MLIR Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:21Z + 2024-12-10T01:35:15Z Daily Trending of MLIR in GitHub \ No newline at end of file diff --git a/modelica/daily/index.xml b/modelica/daily/index.xml index 2d8f93873df..7ca14a97f76 100644 --- a/modelica/daily/index.xml +++ b/modelica/daily/index.xml @@ -1,7 +1,7 @@ GitHub Modelica Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:21Z + 2024-12-10T01:35:15Z Daily Trending of Modelica in GitHub \ No newline at end of file diff --git a/modula-2/daily/index.xml b/modula-2/daily/index.xml index 2004e2f86d7..8e05514b114 100644 --- a/modula-2/daily/index.xml +++ b/modula-2/daily/index.xml @@ -1,7 +1,7 @@ GitHub Modula-2 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:21Z + 2024-12-10T01:35:14Z Daily Trending of Modula-2 in GitHub \ No newline at end of file diff --git a/modula-3/daily/index.xml b/modula-3/daily/index.xml index 278ed3d06f4..3da22bbc9b9 100644 --- a/modula-3/daily/index.xml +++ b/modula-3/daily/index.xml @@ -1,7 +1,7 @@ GitHub Modula-3 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:20Z + 2024-12-10T01:35:15Z Daily Trending of Modula-3 in GitHub \ No newline at end of file diff --git a/module-management-system/daily/index.xml b/module-management-system/daily/index.xml index 895edb16fd6..3dcfd41369c 100644 --- a/module-management-system/daily/index.xml +++ b/module-management-system/daily/index.xml @@ -1,7 +1,7 @@ GitHub Module Management System Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:22Z + 2024-12-10T01:35:16Z Daily Trending of Module Management System in GitHub \ No newline at end of file diff --git a/monkey-c/daily/index.xml b/monkey-c/daily/index.xml index 69906710029..228f7a0af84 100644 --- a/monkey-c/daily/index.xml +++ b/monkey-c/daily/index.xml @@ -1,7 +1,7 @@ GitHub Monkey C Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:22Z + 2024-12-10T01:35:16Z Daily Trending of Monkey C in GitHub \ No newline at end of file diff --git a/monkey/daily/index.xml b/monkey/daily/index.xml index bb645ecb554..4b10bb6b98b 100644 --- a/monkey/daily/index.xml +++ b/monkey/daily/index.xml @@ -1,7 +1,7 @@ GitHub Monkey Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:23Z + 2024-12-10T01:35:17Z Daily Trending of Monkey in GitHub \ No newline at end of file diff --git a/moocode/daily/index.xml b/moocode/daily/index.xml index 0df0dbe0b68..b06624eb4d1 100644 --- a/moocode/daily/index.xml +++ b/moocode/daily/index.xml @@ -1,7 +1,7 @@ GitHub Moocode Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:24Z + 2024-12-10T01:35:18Z Daily Trending of Moocode in GitHub \ No newline at end of file diff --git a/moonscript/daily/index.xml b/moonscript/daily/index.xml index 7c5a6c28b35..77678c9c1fc 100644 --- a/moonscript/daily/index.xml +++ b/moonscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub MoonScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:25Z + 2024-12-10T01:35:19Z Daily Trending of MoonScript in GitHub \ No newline at end of file diff --git a/motoko/daily/index.xml b/motoko/daily/index.xml index 7796bb35fe7..7f6a9ce12e6 100644 --- a/motoko/daily/index.xml +++ b/motoko/daily/index.xml @@ -1,7 +1,7 @@ GitHub Motoko Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:24Z + 2024-12-10T01:35:19Z Daily Trending of Motoko in GitHub \ No newline at end of file diff --git a/motorola-68k-assembly/daily/index.xml b/motorola-68k-assembly/daily/index.xml index ef3cc502a5b..a44176ebfda 100644 --- a/motorola-68k-assembly/daily/index.xml +++ b/motorola-68k-assembly/daily/index.xml @@ -1,7 +1,7 @@ GitHub Motorola 68K Assembly Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:26Z + 2024-12-10T01:35:20Z Daily Trending of Motorola 68K Assembly in GitHub \ No newline at end of file diff --git a/mql4/daily/index.xml b/mql4/daily/index.xml index 15387dd3698..df29e638e97 100644 --- a/mql4/daily/index.xml +++ b/mql4/daily/index.xml @@ -1,7 +1,7 @@ GitHub MQL4 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:26Z + 2024-12-10T01:35:20Z Daily Trending of MQL4 in GitHub \ No newline at end of file diff --git a/mql5/daily/index.xml b/mql5/daily/index.xml index 004bdd225fd..ed3dcced23d 100644 --- a/mql5/daily/index.xml +++ b/mql5/daily/index.xml @@ -1,7 +1,7 @@ GitHub MQL5 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:25Z + 2024-12-10T01:35:20Z Daily Trending of MQL5 in GitHub \ No newline at end of file diff --git a/mtml/daily/index.xml b/mtml/daily/index.xml index d6fdd25bfcb..d2335f3295f 100644 --- a/mtml/daily/index.xml +++ b/mtml/daily/index.xml @@ -1,7 +1,7 @@ GitHub MTML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:27Z + 2024-12-10T01:35:22Z Daily Trending of MTML in GitHub \ No newline at end of file diff --git a/muf/daily/index.xml b/muf/daily/index.xml index 05e35c68037..288a6b5d25e 100644 --- a/muf/daily/index.xml +++ b/muf/daily/index.xml @@ -1,7 +1,7 @@ GitHub MUF Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:28Z + 2024-12-10T01:35:22Z Daily Trending of MUF in GitHub \ No newline at end of file diff --git a/mupad/daily/index.xml b/mupad/daily/index.xml index 79a289a3685..2f6346cb0e8 100644 --- a/mupad/daily/index.xml +++ b/mupad/daily/index.xml @@ -1,7 +1,7 @@ GitHub mupad Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:28Z + 2024-12-10T01:35:22Z Daily Trending of mupad in GitHub \ No newline at end of file diff --git a/muse/daily/index.xml b/muse/daily/index.xml index 323db7741e0..8e0aefaa0e6 100644 --- a/muse/daily/index.xml +++ b/muse/daily/index.xml @@ -1,7 +1,7 @@ GitHub Muse Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:27Z + 2024-12-10T01:35:21Z Daily Trending of Muse in GitHub \ No newline at end of file diff --git a/mustache/daily/index.xml b/mustache/daily/index.xml index 0dc72426e81..eca34a271aa 100644 --- a/mustache/daily/index.xml +++ b/mustache/daily/index.xml @@ -1,7 +1,7 @@ GitHub Mustache Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:30Z + 2024-12-10T01:35:25Z Daily Trending of Mustache in GitHub \ No newline at end of file diff --git a/myghty/daily/index.xml b/myghty/daily/index.xml index c19b702f141..adfe10b960d 100644 --- a/myghty/daily/index.xml +++ b/myghty/daily/index.xml @@ -1,7 +1,7 @@ GitHub Myghty Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:29Z + 2024-12-10T01:35:23Z Daily Trending of Myghty in GitHub \ No newline at end of file diff --git a/nanorc/daily/index.xml b/nanorc/daily/index.xml index 899db7b5610..a46a25f77b2 100644 --- a/nanorc/daily/index.xml +++ b/nanorc/daily/index.xml @@ -1,7 +1,7 @@ GitHub nanorc Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:29Z + 2024-12-10T01:35:23Z Daily Trending of nanorc in GitHub \ No newline at end of file diff --git a/nasl/daily/index.xml b/nasl/daily/index.xml index 7168b2ecaef..0f50671c17d 100644 --- a/nasl/daily/index.xml +++ b/nasl/daily/index.xml @@ -1,7 +1,7 @@ GitHub NASL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:31Z + 2024-12-10T01:35:26Z Daily Trending of NASL in GitHub \ No newline at end of file diff --git a/ncl/daily/index.xml b/ncl/daily/index.xml index 63dfba047d4..8e799beb7a1 100644 --- a/ncl/daily/index.xml +++ b/ncl/daily/index.xml @@ -1,7 +1,7 @@ GitHub NCL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:32Z + 2024-12-10T01:35:26Z Daily Trending of NCL in GitHub \ No newline at end of file diff --git a/nearley/daily/index.xml b/nearley/daily/index.xml index 5fe788d8aa6..b5e32e9a874 100644 --- a/nearley/daily/index.xml +++ b/nearley/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nearley Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:31Z + 2024-12-10T01:35:26Z Daily Trending of Nearley in GitHub \ No newline at end of file diff --git a/nemerle/daily/index.xml b/nemerle/daily/index.xml index 4579f07b9c4..abcfe5ccce6 100644 --- a/nemerle/daily/index.xml +++ b/nemerle/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nemerle Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:31Z + 2024-12-10T01:35:25Z Daily Trending of Nemerle in GitHub \ No newline at end of file diff --git a/neon/daily/index.xml b/neon/daily/index.xml index e0ef86409a5..50b9d79b820 100644 --- a/neon/daily/index.xml +++ b/neon/daily/index.xml @@ -1,7 +1,7 @@ GitHub NEON Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:33Z + 2024-12-10T01:35:27Z Daily Trending of NEON in GitHub \ No newline at end of file diff --git a/nesc/daily/index.xml b/nesc/daily/index.xml index 1755eb3a18f..8d5ea8c1d30 100644 --- a/nesc/daily/index.xml +++ b/nesc/daily/index.xml @@ -1,7 +1,7 @@ GitHub nesC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:33Z + 2024-12-10T01:35:28Z Daily Trending of nesC in GitHub \ No newline at end of file diff --git a/netlinx+erb/daily/index.xml b/netlinx+erb/daily/index.xml index 983d57e9352..1d99f1ffb0c 100644 --- a/netlinx+erb/daily/index.xml +++ b/netlinx+erb/daily/index.xml @@ -1,7 +1,7 @@ GitHub NetLinx+ERB Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:32Z + 2024-12-10T01:35:27Z Daily Trending of NetLinx+ERB in GitHub \ No newline at end of file diff --git a/netlinx/daily/index.xml b/netlinx/daily/index.xml index d08a11e6d81..c70fca05e18 100644 --- a/netlinx/daily/index.xml +++ b/netlinx/daily/index.xml @@ -1,7 +1,7 @@ GitHub NetLinx Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:33Z + 2024-12-10T01:35:28Z Daily Trending of NetLinx in GitHub \ No newline at end of file diff --git a/netlogo/daily/index.xml b/netlogo/daily/index.xml index 3a4545edf7b..939d0dbb1ef 100644 --- a/netlogo/daily/index.xml +++ b/netlogo/daily/index.xml @@ -1,7 +1,7 @@ GitHub NetLogo Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:34Z + 2024-12-10T01:35:29Z Daily Trending of NetLogo in GitHub \ No newline at end of file diff --git a/newlisp/daily/index.xml b/newlisp/daily/index.xml index 6ee5a281dda..aca97bbd34f 100644 --- a/newlisp/daily/index.xml +++ b/newlisp/daily/index.xml @@ -1,7 +1,7 @@ GitHub NewLisp Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:34Z + 2024-12-10T01:35:29Z Daily Trending of NewLisp in GitHub \ No newline at end of file diff --git a/nextflow/daily/index.xml b/nextflow/daily/index.xml index 8c9ca8e0d33..1834006400a 100644 --- a/nextflow/daily/index.xml +++ b/nextflow/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nextflow Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:35Z + 2024-12-10T01:35:30Z Daily Trending of Nextflow in GitHub \ No newline at end of file diff --git a/nginx/daily/index.xml b/nginx/daily/index.xml index 9aea0d7b9ee..35e138ca199 100644 --- a/nginx/daily/index.xml +++ b/nginx/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nginx Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:35Z + 2024-12-10T01:35:29Z Daily Trending of Nginx in GitHub \ No newline at end of file diff --git a/nim/daily/index.xml b/nim/daily/index.xml index 340960c2e1a..922957a8cae 100644 --- a/nim/daily/index.xml +++ b/nim/daily/index.xml @@ -1,14 +1,7 @@ GitHub Nim Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:38Z + 2024-12-10T01:35:31Z Daily Trending of Nim in GitHub - - arnetheduck/nim-results - 2024-12-09T01:33:38Z - tag:github.com,2024-12-09:/arnetheduck/nim-results - - <p>Friendly value-or-error type</p><hr> - \ No newline at end of file diff --git a/ninja/daily/index.xml b/ninja/daily/index.xml index c26571b6afc..f19e4638bb1 100644 --- a/ninja/daily/index.xml +++ b/ninja/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ninja Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:36Z + 2024-12-10T01:35:30Z Daily Trending of Ninja in GitHub \ No newline at end of file diff --git a/nit/daily/index.xml b/nit/daily/index.xml index df0a6cc2f6d..f9e9dc4bfc6 100644 --- a/nit/daily/index.xml +++ b/nit/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nit Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:36Z + 2024-12-10T01:35:31Z Daily Trending of Nit in GitHub \ No newline at end of file diff --git a/nix/daily/index.xml b/nix/daily/index.xml index 16ec1c5cdd6..6654b4cb0a1 100644 --- a/nix/daily/index.xml +++ b/nix/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nix Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:37Z + 2024-12-10T01:35:32Z Daily Trending of Nix in GitHub \ No newline at end of file diff --git a/nl/daily/index.xml b/nl/daily/index.xml index 40bc36676b9..345f1e06d84 100644 --- a/nl/daily/index.xml +++ b/nl/daily/index.xml @@ -1,7 +1,7 @@ GitHub NL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:39Z + 2024-12-10T01:35:33Z Daily Trending of NL in GitHub \ No newline at end of file diff --git a/npm-config/daily/index.xml b/npm-config/daily/index.xml index 9f8296061c6..84643a826d1 100644 --- a/npm-config/daily/index.xml +++ b/npm-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub NPM Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:39Z + 2024-12-10T01:35:34Z Daily Trending of NPM Config in GitHub \ No newline at end of file diff --git a/nsis/daily/index.xml b/nsis/daily/index.xml index 17df61c9bbb..28d32d09a9f 100644 --- a/nsis/daily/index.xml +++ b/nsis/daily/index.xml @@ -1,7 +1,7 @@ GitHub NSIS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:41Z + 2024-12-10T01:35:35Z Daily Trending of NSIS in GitHub \ No newline at end of file diff --git a/nu/daily/index.xml b/nu/daily/index.xml index dbd15560dcb..94c9efd1042 100644 --- a/nu/daily/index.xml +++ b/nu/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nu Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:40Z + 2024-12-10T01:35:35Z Daily Trending of Nu in GitHub \ No newline at end of file diff --git a/numpy/daily/index.xml b/numpy/daily/index.xml index edf76e6eb1b..f50488207da 100644 --- a/numpy/daily/index.xml +++ b/numpy/daily/index.xml @@ -1,7 +1,7 @@ GitHub NumPy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:40Z + 2024-12-10T01:35:34Z Daily Trending of NumPy in GitHub \ No newline at end of file diff --git a/nunjucks/daily/index.xml b/nunjucks/daily/index.xml index 8f721acc447..c679862134c 100644 --- a/nunjucks/daily/index.xml +++ b/nunjucks/daily/index.xml @@ -1,7 +1,7 @@ GitHub Nunjucks Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:41Z + 2024-12-10T01:35:35Z Daily Trending of Nunjucks in GitHub \ No newline at end of file diff --git a/nwscript/daily/index.xml b/nwscript/daily/index.xml index aa525f4fa66..5a4f1789cc1 100644 --- a/nwscript/daily/index.xml +++ b/nwscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub NWScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:42Z + 2024-12-10T01:35:37Z Daily Trending of NWScript in GitHub \ No newline at end of file diff --git a/objdump/daily/index.xml b/objdump/daily/index.xml index 7c4f5f4ee3b..025b6deb7f4 100644 --- a/objdump/daily/index.xml +++ b/objdump/daily/index.xml @@ -1,7 +1,7 @@ GitHub ObjDump Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:45Z + 2024-12-10T01:35:38Z Daily Trending of ObjDump in GitHub \ No newline at end of file diff --git a/object-data-instance-notation/daily/index.xml b/object-data-instance-notation/daily/index.xml index 979c08eada7..a96a49b2fcc 100644 --- a/object-data-instance-notation/daily/index.xml +++ b/object-data-instance-notation/daily/index.xml @@ -1,7 +1,7 @@ GitHub Object Data Instance Notation Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:45Z + 2024-12-10T01:35:39Z Daily Trending of Object Data Instance Notation in GitHub \ No newline at end of file diff --git a/objective-c++/daily/index.xml b/objective-c++/daily/index.xml index 41ba2493c77..7aaed2f3165 100644 --- a/objective-c++/daily/index.xml +++ b/objective-c++/daily/index.xml @@ -1,7 +1,7 @@ GitHub Objective-C++ Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:46Z + 2024-12-10T01:35:40Z Daily Trending of Objective-C++ in GitHub \ No newline at end of file diff --git a/objective-c/daily/index.xml b/objective-c/daily/index.xml index 01cda78d51f..ac5b8de9858 100644 --- a/objective-c/daily/index.xml +++ b/objective-c/daily/index.xml @@ -1,7 +1,7 @@ GitHub Objective-C Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:47Z + 2024-12-10T01:35:41Z Daily Trending of Objective-C in GitHub \ No newline at end of file diff --git a/objective-j/daily/index.xml b/objective-j/daily/index.xml index 1730cc8e2db..ca058ce2316 100644 --- a/objective-j/daily/index.xml +++ b/objective-j/daily/index.xml @@ -1,7 +1,7 @@ GitHub Objective-J Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:46Z + 2024-12-10T01:35:40Z Daily Trending of Objective-J in GitHub \ No newline at end of file diff --git a/objectscript/daily/index.xml b/objectscript/daily/index.xml index 2b1199a72f0..6e1c9c8d3a8 100644 --- a/objectscript/daily/index.xml +++ b/objectscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub ObjectScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:49Z + 2024-12-10T01:35:44Z Daily Trending of ObjectScript in GitHub \ No newline at end of file diff --git a/ocaml/daily/index.xml b/ocaml/daily/index.xml index e8d5f61ec4e..0f7ea652d78 100644 --- a/ocaml/daily/index.xml +++ b/ocaml/daily/index.xml @@ -1,7 +1,7 @@ GitHub OCaml Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:51Z + 2024-12-10T01:35:44Z Daily Trending of OCaml in GitHub \ No newline at end of file diff --git a/odin/daily/index.xml b/odin/daily/index.xml index 6cdcf067c6e..a315b624b42 100644 --- a/odin/daily/index.xml +++ b/odin/daily/index.xml @@ -1,7 +1,7 @@ GitHub Odin Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:50Z + 2024-12-10T01:35:44Z Daily Trending of Odin in GitHub \ No newline at end of file diff --git a/omgrofl/daily/index.xml b/omgrofl/daily/index.xml index 3203facbee5..77c17f31737 100644 --- a/omgrofl/daily/index.xml +++ b/omgrofl/daily/index.xml @@ -1,7 +1,7 @@ GitHub Omgrofl Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:49Z + 2024-12-10T01:35:43Z Daily Trending of Omgrofl in GitHub \ No newline at end of file diff --git a/ooc/daily/index.xml b/ooc/daily/index.xml index 539e4e2a7cb..81f2e2d9582 100644 --- a/ooc/daily/index.xml +++ b/ooc/daily/index.xml @@ -1,7 +1,7 @@ GitHub ooc Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:52Z + 2024-12-10T01:35:45Z Daily Trending of ooc in GitHub \ No newline at end of file diff --git a/opa/daily/index.xml b/opa/daily/index.xml index e4a3fb501bd..52efc06b281 100644 --- a/opa/daily/index.xml +++ b/opa/daily/index.xml @@ -1,7 +1,7 @@ GitHub Opa Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:51Z + 2024-12-10T01:35:46Z Daily Trending of Opa in GitHub \ No newline at end of file diff --git a/opal/daily/index.xml b/opal/daily/index.xml index f3a40c77cda..71ea4e521c1 100644 --- a/opal/daily/index.xml +++ b/opal/daily/index.xml @@ -1,7 +1,7 @@ GitHub Opal Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:53Z + 2024-12-10T01:35:47Z Daily Trending of Opal in GitHub \ No newline at end of file diff --git a/open-policy-agent/daily/index.xml b/open-policy-agent/daily/index.xml index 31251e5eae9..ce75653e7b5 100644 --- a/open-policy-agent/daily/index.xml +++ b/open-policy-agent/daily/index.xml @@ -1,7 +1,7 @@ GitHub Open Policy Agent Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:54Z + 2024-12-10T01:35:48Z Daily Trending of Open Policy Agent in GitHub \ No newline at end of file diff --git a/opencl/daily/index.xml b/opencl/daily/index.xml index 39e710fba71..620e5b137a2 100644 --- a/opencl/daily/index.xml +++ b/opencl/daily/index.xml @@ -1,7 +1,7 @@ GitHub OpenCL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:55Z + 2024-12-10T01:35:49Z Daily Trending of OpenCL in GitHub \ No newline at end of file diff --git a/openedge-abl/daily/index.xml b/openedge-abl/daily/index.xml index 4a4e8e7367c..61ed3b506f9 100644 --- a/openedge-abl/daily/index.xml +++ b/openedge-abl/daily/index.xml @@ -1,7 +1,7 @@ GitHub OpenEdge ABL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:56Z + 2024-12-10T01:35:48Z Daily Trending of OpenEdge ABL in GitHub \ No newline at end of file diff --git a/openqasm/daily/index.xml b/openqasm/daily/index.xml index 4331194a570..10b199e21cc 100644 --- a/openqasm/daily/index.xml +++ b/openqasm/daily/index.xml @@ -1,7 +1,7 @@ GitHub OpenQASM Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:55Z + 2024-12-10T01:35:49Z Daily Trending of OpenQASM in GitHub \ No newline at end of file diff --git a/openrc-runscript/daily/index.xml b/openrc-runscript/daily/index.xml index 24fabb516fd..ba9c9e78fc7 100644 --- a/openrc-runscript/daily/index.xml +++ b/openrc-runscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub OpenRC runscript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:56Z + 2024-12-10T01:35:49Z Daily Trending of OpenRC runscript in GitHub \ No newline at end of file diff --git a/openscad/daily/index.xml b/openscad/daily/index.xml index 0b3f280f78b..008f5d9a1b6 100644 --- a/openscad/daily/index.xml +++ b/openscad/daily/index.xml @@ -1,7 +1,7 @@ GitHub OpenSCAD Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:58Z + 2024-12-10T01:35:50Z Daily Trending of OpenSCAD in GitHub \ No newline at end of file diff --git a/openstep-property-list/daily/index.xml b/openstep-property-list/daily/index.xml index fcfa7b1d29a..4c297eba6c9 100644 --- a/openstep-property-list/daily/index.xml +++ b/openstep-property-list/daily/index.xml @@ -1,7 +1,7 @@ GitHub OpenStep Property List Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:57Z + 2024-12-10T01:35:50Z Daily Trending of OpenStep Property List in GitHub \ No newline at end of file diff --git a/opentype-feature-file/daily/index.xml b/opentype-feature-file/daily/index.xml index cfd6ea0c2c4..80595c4c0e7 100644 --- a/opentype-feature-file/daily/index.xml +++ b/opentype-feature-file/daily/index.xml @@ -1,7 +1,7 @@ GitHub OpenType Feature File Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:56Z + 2024-12-10T01:35:50Z Daily Trending of OpenType Feature File in GitHub \ No newline at end of file diff --git a/org/daily/index.xml b/org/daily/index.xml index 83333a506da..ef944db1ff0 100644 --- a/org/daily/index.xml +++ b/org/daily/index.xml @@ -1,7 +1,7 @@ GitHub Org Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:58Z + 2024-12-10T01:35:52Z Daily Trending of Org in GitHub \ No newline at end of file diff --git a/ox/daily/index.xml b/ox/daily/index.xml index caf4d7f4ee2..7814f8c324e 100644 --- a/ox/daily/index.xml +++ b/ox/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ox Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:59Z + 2024-12-10T01:35:52Z Daily Trending of Ox in GitHub \ No newline at end of file diff --git a/oxygene/daily/index.xml b/oxygene/daily/index.xml index b0302bb8f8d..2c000ff49c4 100644 --- a/oxygene/daily/index.xml +++ b/oxygene/daily/index.xml @@ -1,7 +1,7 @@ GitHub Oxygene Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:59Z + 2024-12-10T01:35:52Z Daily Trending of Oxygene in GitHub \ No newline at end of file diff --git a/oz/daily/index.xml b/oz/daily/index.xml index f5e1477247d..782b06b7980 100644 --- a/oz/daily/index.xml +++ b/oz/daily/index.xml @@ -1,7 +1,7 @@ GitHub Oz Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:59Z + 2024-12-10T01:35:51Z Daily Trending of Oz in GitHub \ No newline at end of file diff --git a/p4/daily/index.xml b/p4/daily/index.xml index 023252b7ab5..fea31dee109 100644 --- a/p4/daily/index.xml +++ b/p4/daily/index.xml @@ -1,7 +1,7 @@ GitHub P4 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:01Z + 2024-12-10T01:35:53Z Daily Trending of P4 in GitHub \ No newline at end of file diff --git a/pan/daily/index.xml b/pan/daily/index.xml index 74e9af93e8a..0f6e100fa48 100644 --- a/pan/daily/index.xml +++ b/pan/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pan Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:00Z + 2024-12-10T01:35:53Z Daily Trending of Pan in GitHub \ No newline at end of file diff --git a/papyrus/daily/index.xml b/papyrus/daily/index.xml index 50b15dce4df..e8ba2019794 100644 --- a/papyrus/daily/index.xml +++ b/papyrus/daily/index.xml @@ -1,7 +1,7 @@ GitHub Papyrus Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:01Z + 2024-12-10T01:35:54Z Daily Trending of Papyrus in GitHub \ No newline at end of file diff --git a/parrot-assembly/daily/index.xml b/parrot-assembly/daily/index.xml index 69b7753d35c..65a14df03da 100644 --- a/parrot-assembly/daily/index.xml +++ b/parrot-assembly/daily/index.xml @@ -1,7 +1,7 @@ GitHub Parrot Assembly Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:02Z + 2024-12-10T01:35:55Z Daily Trending of Parrot Assembly in GitHub \ No newline at end of file diff --git a/parrot-internal-representation/daily/index.xml b/parrot-internal-representation/daily/index.xml index 219c52d474c..95fc66edd2d 100644 --- a/parrot-internal-representation/daily/index.xml +++ b/parrot-internal-representation/daily/index.xml @@ -1,7 +1,7 @@ GitHub Parrot Internal Representation Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:02Z + 2024-12-10T01:35:54Z Daily Trending of Parrot Internal Representation in GitHub \ No newline at end of file diff --git a/parrot/daily/index.xml b/parrot/daily/index.xml index 24ff8ea58e3..19ece419629 100644 --- a/parrot/daily/index.xml +++ b/parrot/daily/index.xml @@ -1,7 +1,7 @@ GitHub Parrot Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:02Z + 2024-12-10T01:35:55Z Daily Trending of Parrot in GitHub \ No newline at end of file diff --git a/pascal/daily/index.xml b/pascal/daily/index.xml index a6638f7c092..13b18d5345e 100644 --- a/pascal/daily/index.xml +++ b/pascal/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pascal Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:03Z + 2024-12-10T01:35:56Z Daily Trending of Pascal in GitHub \ No newline at end of file diff --git a/pawn/daily/index.xml b/pawn/daily/index.xml index 83fb455fc95..dd7eacfe5fe 100644 --- a/pawn/daily/index.xml +++ b/pawn/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pawn Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:04Z + 2024-12-10T01:35:57Z Daily Trending of Pawn in GitHub \ No newline at end of file diff --git a/peg.js/daily/index.xml b/peg.js/daily/index.xml index b68321f9579..4a688cb32cc 100644 --- a/peg.js/daily/index.xml +++ b/peg.js/daily/index.xml @@ -1,7 +1,7 @@ GitHub PEG.js Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:05Z + 2024-12-10T01:35:57Z Daily Trending of PEG.js in GitHub \ No newline at end of file diff --git a/pep8/daily/index.xml b/pep8/daily/index.xml index fc6a1e78c98..02b19919734 100644 --- a/pep8/daily/index.xml +++ b/pep8/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pep8 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:04Z + 2024-12-10T01:35:56Z Daily Trending of Pep8 in GitHub \ No newline at end of file diff --git a/perl/daily/index.xml b/perl/daily/index.xml index f830524d006..39695a5d7c2 100644 --- a/perl/daily/index.xml +++ b/perl/daily/index.xml @@ -1,7 +1,7 @@ GitHub Perl Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:08Z + 2024-12-10T01:36:00Z Daily Trending of Perl in GitHub \ No newline at end of file diff --git a/php/daily/index.xml b/php/daily/index.xml index 985f6aff3c6..d446bbdc9e9 100644 --- a/php/daily/index.xml +++ b/php/daily/index.xml @@ -1,7 +1,7 @@ GitHub PHP Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:12Z + 2024-12-10T01:36:02Z Daily Trending of PHP in GitHub \ No newline at end of file diff --git a/pic/daily/index.xml b/pic/daily/index.xml index 9ec45b02a6e..66c69a22470 100644 --- a/pic/daily/index.xml +++ b/pic/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pic Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:06Z + 2024-12-10T01:36:00Z Daily Trending of Pic in GitHub \ No newline at end of file diff --git a/pickle/daily/index.xml b/pickle/daily/index.xml index 45cd253df70..a83baa75c4a 100644 --- a/pickle/daily/index.xml +++ b/pickle/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pickle Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:06Z + 2024-12-10T01:35:58Z Daily Trending of Pickle in GitHub \ No newline at end of file diff --git a/picolisp/daily/index.xml b/picolisp/daily/index.xml index 88d6c431316..846761b3d02 100644 --- a/picolisp/daily/index.xml +++ b/picolisp/daily/index.xml @@ -1,7 +1,7 @@ GitHub PicoLisp Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:15Z + 2024-12-10T01:36:06Z Daily Trending of PicoLisp in GitHub \ No newline at end of file diff --git a/piglatin/daily/index.xml b/piglatin/daily/index.xml index aac1d552eba..81fad148352 100644 --- a/piglatin/daily/index.xml +++ b/piglatin/daily/index.xml @@ -1,7 +1,7 @@ GitHub PigLatin Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:16Z + 2024-12-10T01:36:06Z Daily Trending of PigLatin in GitHub \ No newline at end of file diff --git a/pike/daily/index.xml b/pike/daily/index.xml index a037e230a1c..0e251087f2e 100644 --- a/pike/daily/index.xml +++ b/pike/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pike Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:15Z + 2024-12-10T01:36:06Z Daily Trending of Pike in GitHub \ No newline at end of file diff --git a/plantuml/daily/index.xml b/plantuml/daily/index.xml index 1df1a8d8748..46449fd8ab5 100644 --- a/plantuml/daily/index.xml +++ b/plantuml/daily/index.xml @@ -1,7 +1,7 @@ GitHub PlantUML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:16Z + 2024-12-10T01:36:08Z Daily Trending of PlantUML in GitHub \ No newline at end of file diff --git a/plpgsql/daily/index.xml b/plpgsql/daily/index.xml index b736dfa7bee..17f087fa807 100644 --- a/plpgsql/daily/index.xml +++ b/plpgsql/daily/index.xml @@ -1,7 +1,7 @@ GitHub PLpgSQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:17Z + 2024-12-10T01:36:08Z Daily Trending of PLpgSQL in GitHub \ No newline at end of file diff --git a/plsql/daily/index.xml b/plsql/daily/index.xml index ffa0ac6928a..aa795d12d7c 100644 --- a/plsql/daily/index.xml +++ b/plsql/daily/index.xml @@ -1,7 +1,7 @@ GitHub PLSQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:17Z + 2024-12-10T01:36:07Z Daily Trending of PLSQL in GitHub \ No newline at end of file diff --git a/pod-6/daily/index.xml b/pod-6/daily/index.xml index 650e88f29ed..04757b664f0 100644 --- a/pod-6/daily/index.xml +++ b/pod-6/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pod 6 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:18Z + 2024-12-10T01:36:09Z Daily Trending of Pod 6 in GitHub \ No newline at end of file diff --git a/pod/daily/index.xml b/pod/daily/index.xml index d396f1484cf..6981acdef7b 100644 --- a/pod/daily/index.xml +++ b/pod/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pod Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:19Z + 2024-12-10T01:36:09Z Daily Trending of Pod in GitHub \ No newline at end of file diff --git a/pogoscript/daily/index.xml b/pogoscript/daily/index.xml index 8d8e21bdbca..2a9ff869623 100644 --- a/pogoscript/daily/index.xml +++ b/pogoscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub PogoScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:18Z + 2024-12-10T01:36:10Z Daily Trending of PogoScript in GitHub \ No newline at end of file diff --git a/pony/daily/index.xml b/pony/daily/index.xml index a8f9ed125a8..e01329dbbab 100644 --- a/pony/daily/index.xml +++ b/pony/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pony Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:21Z + 2024-12-10T01:36:10Z Daily Trending of Pony in GitHub \ No newline at end of file diff --git a/postcss/daily/index.xml b/postcss/daily/index.xml index d252d69edc2..c8284644415 100644 --- a/postcss/daily/index.xml +++ b/postcss/daily/index.xml @@ -1,7 +1,7 @@ GitHub PostCSS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:20Z + 2024-12-10T01:36:10Z Daily Trending of PostCSS in GitHub \ No newline at end of file diff --git a/postscript/daily/index.xml b/postscript/daily/index.xml index 6bcc14bbf00..b21181bac7f 100644 --- a/postscript/daily/index.xml +++ b/postscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub PostScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:21Z + 2024-12-10T01:36:11Z Daily Trending of PostScript in GitHub \ No newline at end of file diff --git a/pov-ray-sdl/daily/index.xml b/pov-ray-sdl/daily/index.xml index 9fa08a83d62..b58e400e3cc 100644 --- a/pov-ray-sdl/daily/index.xml +++ b/pov-ray-sdl/daily/index.xml @@ -1,7 +1,7 @@ GitHub POV-Ray SDL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:21Z + 2024-12-10T01:36:12Z Daily Trending of POV-Ray SDL in GitHub \ No newline at end of file diff --git a/powerbuilder/daily/index.xml b/powerbuilder/daily/index.xml index 21d62857030..5847c9e0c8a 100644 --- a/powerbuilder/daily/index.xml +++ b/powerbuilder/daily/index.xml @@ -1,7 +1,7 @@ GitHub PowerBuilder Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:22Z + 2024-12-10T01:36:12Z Daily Trending of PowerBuilder in GitHub \ No newline at end of file diff --git a/powershell/daily/index.xml b/powershell/daily/index.xml index dc36c3767d2..0b3bbcc3146 100644 --- a/powershell/daily/index.xml +++ b/powershell/daily/index.xml @@ -1,7 +1,7 @@ GitHub PowerShell Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:23Z + 2024-12-10T01:36:14Z Daily Trending of PowerShell in GitHub \ No newline at end of file diff --git a/prisma/daily/index.xml b/prisma/daily/index.xml index f60f2a54e4a..c34539a9b97 100644 --- a/prisma/daily/index.xml +++ b/prisma/daily/index.xml @@ -1,7 +1,7 @@ GitHub Prisma Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:26Z + 2024-12-10T01:36:17Z Daily Trending of Prisma in GitHub \ No newline at end of file diff --git a/processing/daily/index.xml b/processing/daily/index.xml index 86f72a70547..04ea84dd398 100644 --- a/processing/daily/index.xml +++ b/processing/daily/index.xml @@ -1,7 +1,7 @@ GitHub Processing Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:27Z + 2024-12-10T01:36:18Z Daily Trending of Processing in GitHub \ No newline at end of file diff --git a/procfile/daily/index.xml b/procfile/daily/index.xml index a9db22a56c9..f46856c2e62 100644 --- a/procfile/daily/index.xml +++ b/procfile/daily/index.xml @@ -1,7 +1,7 @@ GitHub Procfile Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:27Z + 2024-12-10T01:36:17Z Daily Trending of Procfile in GitHub \ No newline at end of file diff --git a/proguard/daily/index.xml b/proguard/daily/index.xml index fc1f44b2254..a268d5f63d1 100644 --- a/proguard/daily/index.xml +++ b/proguard/daily/index.xml @@ -1,7 +1,7 @@ GitHub Proguard Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:27Z + 2024-12-10T01:36:17Z Daily Trending of Proguard in GitHub \ No newline at end of file diff --git a/prolog/daily/index.xml b/prolog/daily/index.xml index d09047d2091..557c199a16c 100644 --- a/prolog/daily/index.xml +++ b/prolog/daily/index.xml @@ -1,7 +1,7 @@ GitHub Prolog Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:29Z + 2024-12-10T01:36:19Z Daily Trending of Prolog in GitHub \ No newline at end of file diff --git a/promela/daily/index.xml b/promela/daily/index.xml index da8a3e86b31..861cdde94d7 100644 --- a/promela/daily/index.xml +++ b/promela/daily/index.xml @@ -1,7 +1,7 @@ GitHub Promela Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:28Z + 2024-12-10T01:36:18Z Daily Trending of Promela in GitHub \ No newline at end of file diff --git a/propeller-spin/daily/index.xml b/propeller-spin/daily/index.xml index 45bdf607375..179ed101183 100644 --- a/propeller-spin/daily/index.xml +++ b/propeller-spin/daily/index.xml @@ -1,7 +1,7 @@ GitHub Propeller Spin Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:29Z + 2024-12-10T01:36:19Z Daily Trending of Propeller Spin in GitHub \ No newline at end of file diff --git a/protocol-buffer-text-format/daily/index.xml b/protocol-buffer-text-format/daily/index.xml index cf2967997d1..09503e6e3e3 100644 --- a/protocol-buffer-text-format/daily/index.xml +++ b/protocol-buffer-text-format/daily/index.xml @@ -1,7 +1,7 @@ GitHub Protocol Buffer Text Format Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:30Z + 2024-12-10T01:36:20Z Daily Trending of Protocol Buffer Text Format in GitHub \ No newline at end of file diff --git a/protocol-buffer/daily/index.xml b/protocol-buffer/daily/index.xml index 16a3da46d13..e90c9eb4b5a 100644 --- a/protocol-buffer/daily/index.xml +++ b/protocol-buffer/daily/index.xml @@ -1,7 +1,7 @@ GitHub Protocol Buffer Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:28Z + 2024-12-10T01:36:19Z Daily Trending of Protocol Buffer in GitHub \ No newline at end of file diff --git a/public-key/daily/index.xml b/public-key/daily/index.xml index ee559ade5d6..980dfcb56b9 100644 --- a/public-key/daily/index.xml +++ b/public-key/daily/index.xml @@ -1,7 +1,7 @@ GitHub Public Key Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:30Z + 2024-12-10T01:36:21Z Daily Trending of Public Key in GitHub \ No newline at end of file diff --git a/pug/daily/index.xml b/pug/daily/index.xml index 28ece4d3f15..fba9cb49d8d 100644 --- a/pug/daily/index.xml +++ b/pug/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pug Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:31Z + 2024-12-10T01:36:21Z Daily Trending of Pug in GitHub \ No newline at end of file diff --git a/puppet/daily/index.xml b/puppet/daily/index.xml index 339917407b7..750fe54df5a 100644 --- a/puppet/daily/index.xml +++ b/puppet/daily/index.xml @@ -1,7 +1,7 @@ GitHub Puppet Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:30Z + 2024-12-10T01:36:20Z Daily Trending of Puppet in GitHub \ No newline at end of file diff --git a/pure-data/daily/index.xml b/pure-data/daily/index.xml index e5eafcc3be7..4eb3c7c8ebc 100644 --- a/pure-data/daily/index.xml +++ b/pure-data/daily/index.xml @@ -1,7 +1,7 @@ GitHub Pure Data Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:32Z + 2024-12-10T01:36:22Z Daily Trending of Pure Data in GitHub \ No newline at end of file diff --git a/purebasic/daily/index.xml b/purebasic/daily/index.xml index e9a496a0b11..8c482b4e5fc 100644 --- a/purebasic/daily/index.xml +++ b/purebasic/daily/index.xml @@ -1,7 +1,7 @@ GitHub PureBasic Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:31Z + 2024-12-10T01:36:22Z Daily Trending of PureBasic in GitHub \ No newline at end of file diff --git a/purescript/daily/index.xml b/purescript/daily/index.xml index 1c560f28a1a..0bfa787ccc2 100644 --- a/purescript/daily/index.xml +++ b/purescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub PureScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:32Z + 2024-12-10T01:36:23Z Daily Trending of PureScript in GitHub \ No newline at end of file diff --git a/python-console/daily/index.xml b/python-console/daily/index.xml index 0e078e2da5a..bf2ddf7aa27 100644 --- a/python-console/daily/index.xml +++ b/python-console/daily/index.xml @@ -1,7 +1,7 @@ GitHub Python console Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:33Z + 2024-12-10T01:36:24Z Daily Trending of Python console in GitHub \ No newline at end of file diff --git a/python-traceback/daily/index.xml b/python-traceback/daily/index.xml index cbcc99da9a6..b7088ce67c5 100644 --- a/python-traceback/daily/index.xml +++ b/python-traceback/daily/index.xml @@ -1,7 +1,7 @@ GitHub Python traceback Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:34Z + 2024-12-10T01:36:24Z Daily Trending of Python traceback in GitHub \ No newline at end of file diff --git a/python/daily/index.xml b/python/daily/index.xml index 7133ca79d12..d756a234a13 100644 --- a/python/daily/index.xml +++ b/python/daily/index.xml @@ -1,14 +1,14 @@ GitHub Python Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:35Z + 2024-12-10T01:36:25Z Daily Trending of Python in GitHub - pathwaycom/pathway - 2024-12-09T01:34:35Z - tag:github.com,2024-12-09:/pathwaycom/pathway - - <p>Python ETL framework for stream processing, real-time analytics, LLM pipelines, and RAG.</p><hr><div align="center"> <a href="https://pathway.com/"> <img src="https://pathway.com/logo-light.svg?sanitize=true"> </a> <br> <br> </div> <p align="center"> <a href="https://github.com/pathwaycom/pathway/actions/workflows/ubuntu_test.yml"> <img src="https://github.com/pathwaycom/pathway/actions/workflows/ubuntu_test.yml/badge.svg?sanitize=true" alt="ubuntu"> <br> </a><a href="https://github.com/pathwaycom/pathway/actions/workflows/release.yml"> <img src="https://github.com/pathwaycom/pathway/actions/workflows/release.yml/badge.svg?sanitize=true" alt="Last release"></a> <a href="https://badge.fury.io/py/pathway"><img src="https://badge.fury.io/py/pathway.svg?sanitize=true" alt="PyPI version" height="18"></a> <a href="https://badge.fury.io/py/pathway"><img src="https://static.pepy.tech/badge/pathway" alt="PyPI downloads" height="18"></a> <a href="https://github.com/pathwaycom/pathway/raw/main/LICENSE.txt"> <img src="https://img.shields.io/badge/license-BSL-green" alt="License: BSL"></a> <br> <a href="https://discord.gg/pathway"> <img src="https://img.shields.io/discord/1042405378304004156?logo=discord" alt="chat on Discord"></a> <a href="https://twitter.com/intent/follow?screen_name=pathway_com"> <img src="https://img.shields.io/twitter/follow/pathwaycom" alt="follow on Twitter"></a> <a href="https://linkedin.com/company/pathway"> <img src="https://img.shields.io/badge/pathway-0077B5?style=social&amp;logo=linkedin" alt="follow on LinkedIn"></a> <a href="https://github.com/dylanhogg/awesome-python/raw/main/README.md"> <img src="https://awesome.re/badge.svg?sanitize=true" alt="Awesome Python"></a> <a href="https://gurubase.io/g/pathway"> <img src="https://img.shields.io/badge/Gurubase-Ask%20Pathway%20Guru-006BFF" alt="Pathway Guru"></a> <br> <a href="https://raw.githubusercontent.com/pathwaycom/pathway/main/#getting-started">Getting Started</a> | <a href="https://raw.githubusercontent.com/pathwaycom/pathway/main/#deployment">Deployment</a> | <a href="https://raw.githubusercontent.com/pathwaycom/pathway/main/#resources">Documentation and Support</a> | <a href="https://pathway.com/blog/">Blog</a> | <a href="https://raw.githubusercontent.com/pathwaycom/pathway/main/#license">License</a> </p> <h1>Pathway<a id="pathway"> Live Data Framework</a></h1> <p><a href="https://pathway.com">Pathway</a> is a Python ETL framework for stream processing, real-time analytics, LLM pipelines, and RAG.</p> <p>Pathway comes with an <strong>easy-to-use Python API</strong>, allowing you to seamlessly integrate your favorite Python ML libraries. Pathway code is versatile and robust: <strong>you can use it in both development and production environments, handling both batch and streaming data effectively</strong>. The same code can be used for local development, CI/CD tests, running batch jobs, handling stream replays, and processing data streams.</p> <p>Pathway is powered by a <strong>scalable Rust engine</strong> based on Differential Dataflow and performs incremental computation. Your Pathway code, despite being written in Python, is run by the Rust engine, enabling multithreading, multiprocessing, and distributed computations. All the pipeline is kept in memory and can be easily deployed with <strong>Docker and Kubernetes</strong>.</p> <p>You can install Pathway with pip:</p> <pre><code>pip install -U pathway </code></pre> <p>For any questions, you will find the community and team behind the project <a href="https://discord.com/invite/pathway">on Discord</a>.</p> <h2>Use-cases and templates</h2> <p>Ready to see what Pathway can do?</p> <p><a href="https://pathway.com/developers/templates">Try one of our easy-to-run examples</a>!</p> <p>Available in both notebook and docker formats, these ready-to-launch examples can be launched in just a few clicks. Pick one and start your hands-on experience with Pathway today!</p> <h3>Event processing and real-time analytics pipelines</h3> <p>With its unified engine for batch and streaming and its full Python compatibility, Pathway makes data processing as easy as possible. It's the ideal solution for a wide range of data processing pipelines, including:</p> <ul> <li><a href="https://pathway.com/developers/templates/kafka-etl">Showcase: Real-time ETL.</a></li> <li><a href="https://pathway.com/developers/templates/realtime-log-monitoring">Showcase: Event-driven pipelines with alerting.</a></li> <li><a href="https://pathway.com/developers/templates/linear_regression_with_kafka/">Showcase: Realtime analytics.</a></li> <li><a href="https://pathway.com/developers/user-guide/connecting-to-data/switch-from-batch-to-streaming">Docs: Switch from batch to streaming.</a></li> </ul> <h3>AI Pipelines</h3> <p>Pathway provides dedicated LLM tooling to build live LLM and RAG pipelines. Wrappers for most common LLM services and utilities are included, making working with LLMs and RAGs pipelines incredibly easy. Check out our <a href="https://pathway.com/developers/user-guide/llm-xpack/overview">LLM xpack documentation</a>.</p> <p>Don't hesitate to try one of our runnable examples featuring LLM tooling. You can find such examples <a href="https://pathway.com/developers/user-guide/llm-xpack/llm-examples">here</a>.</p> <ul> <li><a href="https://pathway.com/developers/templates/unstructured-to-structured/">Template: Unstructured data to SQL on-the-fly.</a></li> <li><a href="https://pathway.com/developers/templates/private-rag-ollama-mistral">Template: Private RAG with Ollama and Mistral AI</a></li> <li><a href="https://pathway.com/developers/templates/adaptive-rag">Template: Adaptive RAG</a></li> <li><a href="https://pathway.com/developers/templates/multimodal-rag">Template: Multimodal RAG with gpt-4o</a></li> </ul> <h2>Features</h2> <ul> <li><strong>A wide range of connectors</strong>: Pathway comes with connectors that connect to external data sources such as Kafka, GDrive, PostgreSQL, or SharePoint. Its Airbyte connector allows you to connect to more than 300 different data sources. If the connector you want is not available, you can build your own custom connector using Pathway Python connector.</li> <li><strong>Stateless and stateful transformations</strong>: Pathway supports stateful transformations such as joins, windowing, and sorting. It provides many transformations directly implemented in Rust. In addition to the provided transformation, you can use any Python function. You can implement your own or you can use any Python library to process your data.</li> <li><strong>Persistence</strong>: Pathway provides persistence to save the state of the computation. This allows you to restart your pipeline after an update or a crash. Your pipelines are in good hands with Pathway!</li> <li><strong>Consistency</strong>: Pathway handles the time for you, making sure all your computations are consistent. In particular, Pathway manages late and out-of-order points by updating its results whenever new (or late, in this case) data points come into the system. The free version of Pathway gives the "at least once" consistency while the enterprise version provides the "exactly once" consistency.</li> <li><strong>Scalable Rust engine</strong>: with Pathway Rust engine, you are free from the usual limits imposed by Python. You can easily do multithreading, multiprocessing, and distributed computations.</li> <li><strong>LLM helpers</strong>: Pathway provides an LLM extension with all the utilities to integrate LLMs with your data pipelines (LLM wrappers, parsers, embedders, splitters), including an in-memory real-time Vector Index, and integrations with LLamaIndex and LangChain. You can quickly build and deploy RAG applications with your live documents.</li> </ul> <h2>Getting started<a id="getting-started"></a></h2> <h3>Installation<a id="installation"></a></h3> <p>Pathway requires Python 3.10 or above.</p> <p>You can install the current release of Pathway using <code>pip</code>:</p> <pre><code>$ pip install -U pathway </code></pre> <p>⚠️ Pathway is available on MacOS and Linux. Users of other systems should run Pathway on a Virtual Machine.</p> <h3>Example: computing the sum of positive values in real time.<a id="example"></a></h3> <pre><code class="language-python">import pathway as pw # Define the schema of your data (Optional) class InputSchema(pw.Schema): value: int # Connect to your data using connectors input_table = pw.io.csv.read( "./input/", schema=InputSchema ) #Define your operations on the data filtered_table = input_table.filter(input_table.value&gt;=0) result_table = filtered_table.reduce( sum_value = pw.reducers.sum(filtered_table.value) ) # Load your results to external systems pw.io.jsonlines.write(result_table, "output.jsonl") # Run the computation pw.run() </code></pre> <p>Run Pathway <a href="https://colab.research.google.com/drive/1aBIJ2HCng-YEUOMrr0qtj0NeZMEyRz55?usp=sharing">in Google Colab</a>.</p> <p>You can find more examples <a href="https://github.com/pathwaycom/pathway/tree/main/examples">here</a>.</p> <h2>Deployment<a id="deployment"></a></h2> <h3>Locally<a id="running-pathway-locally"></a></h3> <p>To use Pathway, you only need to import it:</p> <pre><code class="language-python">import pathway as pw </code></pre> <p>Now, you can easily create your processing pipeline, and let Pathway handle the updates. Once your pipeline is created, you can launch the computation on streaming data with a one-line command:</p> <pre><code class="language-python">pw.run() </code></pre> <p>You can then run your Pathway project (say, <code>main.py</code>) just like a normal Python script: <code>$ python main.py</code>. Pathway comes with a monitoring dashboard that allows you to keep track of the number of messages sent by each connector and the latency of the system. The dashboard also includes log messages.</p> <img src="https://d14l3brkh44201.cloudfront.net/pathway-dashboard.png" width="1326" alt="Pathway dashboard"> <p>Alternatively, you can use the pathway'ish version:</p> <pre><code>$ pathway spawn python main.py </code></pre> <p>Pathway natively supports multithreading. To launch your application with 3 threads, you can do as follows:</p> <pre><code>$ pathway spawn --threads 3 python main.py </code></pre> <p>To jumpstart a Pathway project, you can use our <a href="https://github.com/pathwaycom/cookiecutter-pathway">cookiecutter template</a>.</p> <h3>Docker<a id="docker"></a></h3> <p>You can easily run Pathway using docker.</p> <h4>Pathway image</h4> <p>You can use the <a href="https://hub.docker.com/r/pathwaycom/pathway">Pathway docker image</a>, using a Dockerfile:</p> <pre><code class="language-dockerfile">FROM pathwaycom/pathway:latest WORKDIR /app COPY requirements.txt ./ RUN pip install --no-cache-dir -r requirements.txt COPY . . CMD [ "python", "./your-script.py" ] </code></pre> <p>You can then build and run the Docker image:</p> <pre><code class="language-console">docker build -t my-pathway-app . docker run -it --rm --name my-pathway-app my-pathway-app </code></pre> <h4>Run a single Python script</h4> <p>When dealing with single-file projects, creating a full-fledged <code>Dockerfile</code> might seem unnecessary. In such scenarios, you can execute a Python script directly using the Pathway Docker image. For example:</p> <pre><code class="language-console">docker run -it --rm --name my-pathway-app -v "$PWD":/app pathwaycom/pathway:latest python my-pathway-app.py </code></pre> <h4>Python docker image</h4> <p>You can also use a standard Python image and install Pathway using pip with a Dockerfile:</p> <pre><code class="language-dockerfile">FROM --platform=linux/x86_64 python:3.10 RUN pip install -U pathway COPY ./pathway-script.py pathway-script.py CMD ["python", "-u", "pathway-script.py"] </code></pre> <h3>Kubernetes and cloud<a id="k8s"></a></h3> <p>Docker containers are ideally suited for deployment on the cloud with Kubernetes. If you want to scale your Pathway application, you may be interested in our Pathway for Enterprise. Pathway for Enterprise is specially tailored towards end-to-end data processing and real time intelligent analytics. It scales using distributed computing on the cloud and supports distributed Kubernetes deployment, with external persistence setup.</p> <p>You can easily deploy Pathway using services like Render: see <a href="https://pathway.com/developers/user-guide/deployment/render-deploy/">how to deploy Pathway in a few clicks</a>.</p> <p>If you are interested, don't hesitate to <a href="mailto:contact@pathway.com">contact us</a> to learn more.</p> <h2>Performance<a id="performance"></a></h2> <p>Pathway is made to outperform state-of-the-art technologies designed for streaming and batch data processing tasks, including: Flink, Spark, and Kafka Streaming. It also makes it possible to implement a lot of algorithms/UDF's in streaming mode which are not readily supported by other streaming frameworks (especially: temporal joins, iterative graph algorithms, machine learning routines).</p> <p>If you are curious, here are <a href="https://github.com/pathwaycom/pathway-benchmarks">some benchmarks to play with</a>.</p> <img src="https://github.com/pathwaycom/pathway-benchmarks/raw/main/images/bm-wordcount-lineplot.png" width="1326" alt="WordCount Graph"> <h2>Documentation and Support<a id="resources"></a></h2> <p>The entire documentation of Pathway is available at <a href="https://pathway.com/developers/">pathway.com/developers/</a>, including the <a href="https://pathway.com/developers/api-docs/pathway">API Docs</a>.</p> <p>If you have any question, don't hesitate to <a href="https://github.com/pathwaycom/pathway/issues">open an issue on GitHub</a>, join us on <a href="https://discord.com/invite/pathway">Discord</a>, or send us an email at <a href="mailto:contact@pathway.com">contact@pathway.com</a>.</p> <h2>License<a id="license"></a></h2> <p>Pathway is distributed on a <a href="https://github.com/pathwaycom/pathway/raw/main/LICENSE.txt">BSL 1.1 License</a> which allows for unlimited non-commercial use, as well as use of the Pathway package <a href="https://pathway.com/license/">for most commercial purposes</a>, free of charge. Code in this repository automatically converts to Open Source (Apache 2.0 License) after 4 years. Some <a href="https://github.com/pathwaycom">public repos</a> which are complementary to this one (examples, libraries, connectors, etc.) are licensed as Open Source, under the MIT license.</p> <h2>Contribution guidelines<a id="contribution-guidelines"></a></h2> <p>If you develop a library or connector which you would like to integrate with this repo, we suggest releasing it first as a separate repo on a MIT/Apache 2.0 license.</p> <p>For all concerns regarding core Pathway functionalities, Issues are encouraged. For further information, don't hesitate to engage with Pathway's <a href="https://discord.gg/pathway">Discord community</a>.</p> + kijai/ComfyUI-CogVideoXWrapper + 2024-12-10T01:36:25Z + tag:github.com,2024-12-10:/kijai/ComfyUI-CogVideoXWrapper + + <p></p><hr><h1>WORK IN PROGRESS</h1> <p>Spreadsheet (WIP) of supported models and their supported features: <a href="https://docs.google.com/spreadsheets/d/16eA6mSL8XkTcu9fSWkPSHfRIqyAKJbR1O99xnuGdCKY/edit?usp=sharing">https://docs.google.com/spreadsheets/d/16eA6mSL8XkTcu9fSWkPSHfRIqyAKJbR1O99xnuGdCKY/edit?usp=sharing</a></p> <h2>BREAKING Update8</h2> <p>This is big one, and unfortunately to do the necessary cleanup and refactoring this will break every old workflow as they are. I apologize for the inconvenience, if I don't do this now I'll keep making it worse until maintaining becomes too much of a chore, so from my pov there was no choice.</p> <p><em>Please either use the new workflows or fix the nodes in your old ones before posting issue reports!</em></p> <p>Old version will be kept in a legacy branch, but not maintained</p> <ul> <li> <p>Support CogVideoX 1.5 models</p> </li> <li> <p>Major code cleanup (it was bad, still isn't great, wip)</p> </li> <li> <p>Merge Fun -model functionality into main pipeline:</p> <ul> <li>All Fun specific nodes, besides image encode node for Fun -InP models are gone</li> <li>Main CogVideo Sampler works with Fun models</li> <li>DimensionX LoRAs now work with Fun models as well</li> </ul> </li> <li> <p>Remove width/height from the sampler widgets and detect from input instead, this meanst text2vid now requires using empty latents</p> </li> <li> <p>Separate VAE from the model, allow using fp32 VAE</p> </li> <li> <p>Add ability to load some of the non-GGUF models as single files (only few available for now: <a href="https://huggingface.co/Kijai/CogVideoX-comfy">https://huggingface.co/Kijai/CogVideoX-comfy</a>)</p> </li> <li> <p>Add some torchao quantizations as options</p> </li> <li> <p>Add interpolation as option for the main encode node, old interpolation specific node is gone</p> </li> <li> <p>torch.compile optimizations</p> </li> <li> <p>Remove PAB in favor of FasterCache and cleaner code</p> </li> <li> <p>other smaller things I forgot about at this point</p> </li> </ul> <p>For Fun -model based workflows it's more drastic change, for others migrating generally means re-setting many of the nodes.</p> <h2>Update7</h2> <ul> <li>Refactored the Fun version's sampler to accept any resolution, this should make it lot simpler to use with Tora. <strong>BREAKS OLD WORKFLOWS</strong>, old FunSampler nodes need to be remade.</li> <li>The old bucket resizing is now on it's own node (CogVideoXFunResizeToClosestBucket) to keep the functionality, I honestly don't know if it matters at all, but just in case.</li> <li>Fun version's vid2vid is now also in the same node, the old vid2vid node is deprecated.</li> <li>Added support for FasterCache, this trades more VRAM use for speed with slight quality hit, similar to PAB: <a href="https://github.com/Vchitect/FasterCache">https://github.com/Vchitect/FasterCache</a></li> <li>Improved torch.compile support, it actually works now</li> </ul> <h2>Update6</h2> <p>Initial support for Tora (<a href="https://github.com/alibaba/Tora">https://github.com/alibaba/Tora</a>)</p> <p>Converted model (included in the autodownload node):</p> <p><a href="https://huggingface.co/Kijai/CogVideoX-5b-Tora/tree/main">https://huggingface.co/Kijai/CogVideoX-5b-Tora/tree/main</a></p> <p><a href="https://github.com/user-attachments/assets/d5334237-03dc-48f5-8bec-3ae5998660c6">https://github.com/user-attachments/assets/d5334237-03dc-48f5-8bec-3ae5998660c6</a></p> <h2>Update5</h2> <p>This week there's been some bigger updates that will most likely affect some old workflows, sampler node especially probably need to be refreshed (re-created) if it errors out!</p> <p>New features:</p> <ul> <li>Initial context windowing with FreeNoise noise shuffling mainly for vid2vid and pose2vid pipelines for longer generations, haven't figured it out for img2vid yet</li> <li>GGUF models and tiled encoding for I2V and pose pipelines (thanks to MinusZoneAI)</li> <li><a href="https://github.com/thu-ml/SageAttention">sageattention</a> support (Linux only) for a speed boost, I experienced ~20-30% increase with it, stacks with fp8 fast mode, doesn't need compiling</li> <li>Support CogVideoX-Fun 1.1 and it's pose models with additional control strength and application step settings, this model's input does NOT have to be just dwpose skeletons, just about anything can work</li> <li>Support LoRAs</li> </ul> <p><a href="https://github.com/user-attachments/assets/ddeb8f38-a647-42b3-a4b1-c6936f961deb">https://github.com/user-attachments/assets/ddeb8f38-a647-42b3-a4b1-c6936f961deb</a></p> <p><a href="https://github.com/user-attachments/assets/c78b2832-9571-4941-8c97-fbcc1a4cc23d">https://github.com/user-attachments/assets/c78b2832-9571-4941-8c97-fbcc1a4cc23d</a></p> <p><a href="https://github.com/user-attachments/assets/d9ed98b1-f917-432b-a16e-e01e87efb1f9">https://github.com/user-attachments/assets/d9ed98b1-f917-432b-a16e-e01e87efb1f9</a></p> <h2>Update4</h2> <p>Initial support for the official I2V version of CogVideoX: <a href="https://huggingface.co/THUDM/CogVideoX-5b-I2V">https://huggingface.co/THUDM/CogVideoX-5b-I2V</a></p> <p><strong>Also needs diffusers 0.30.3</strong></p> <p><a href="https://github.com/user-attachments/assets/c672d0af-a676-495d-a42c-7e3dd802b4b0">https://github.com/user-attachments/assets/c672d0af-a676-495d-a42c-7e3dd802b4b0</a></p> <h2>Update3</h2> <p>Added initial support for CogVideoX-Fun: <a href="https://github.com/aigc-apps/CogVideoX-Fun">https://github.com/aigc-apps/CogVideoX-Fun</a></p> <p>Note that while this one can do image2vid, this is NOT the official I2V model yet, though it should also be released very soon.</p> <p><a href="https://github.com/user-attachments/assets/68f9ed16-ee53-4955-b931-1799461ac561">https://github.com/user-attachments/assets/68f9ed16-ee53-4955-b931-1799461ac561</a></p> <h2>Updade2</h2> <p>Added <strong>experimental</strong> support for onediff, this reduced sampling time by ~40% for me, reaching 4.23 s/it on 4090 with 49 frames. This requires using Linux, torch 2.4.0, onediff and nexfort installation:</p> <p><code>pip install --pre onediff onediffx</code></p> <p><code>pip install nexfort</code></p> <p>First run will take around 5 mins for the compilation.</p> <h2>Update</h2> <p>5b model is now also supported for basic text2vid: <a href="https://huggingface.co/THUDM/CogVideoX-5b">https://huggingface.co/THUDM/CogVideoX-5b</a></p> <p>It is also autodownloaded to <code>ComfyUI/models/CogVideo/CogVideoX-5b</code>, text encoder is not needed as we use the ComfyUI T5.</p> <p><a href="https://github.com/user-attachments/assets/991205cc-826e-4f93-831a-c10441f0f2ce">https://github.com/user-attachments/assets/991205cc-826e-4f93-831a-c10441f0f2ce</a></p> <p>Requires diffusers 0.30.1 (this is specified in requirements.txt)</p> <p>Uses same T5 model than SD3 and Flux, fp8 works fine too. Memory requirements depend mostly on the video length. VAE decoding seems to be the only big that takes a lot of VRAM when everything is offloaded, peaks at around 13-14GB momentarily at that stage. Sampling itself takes only maybe 5-6GB.</p> <p>Hacked in img2img to attempt vid2vid workflow, works interestingly with some inputs, highly experimental.</p> <p><a href="https://github.com/user-attachments/assets/e6951ef4-ea7a-4752-94f6-cf24f2503d83">https://github.com/user-attachments/assets/e6951ef4-ea7a-4752-94f6-cf24f2503d83</a></p> <p><a href="https://github.com/user-attachments/assets/9e41f37b-2bb3-411c-81fa-e91b80da2559">https://github.com/user-attachments/assets/9e41f37b-2bb3-411c-81fa-e91b80da2559</a></p> <p>Also added temporal tiling as means of generating endless videos:</p> <p><a href="https://github.com/kijai/ComfyUI-CogVideoXWrapper">https://github.com/kijai/ComfyUI-CogVideoXWrapper</a></p> <p><a href="https://github.com/user-attachments/assets/ecdac8b8-d434-48b6-abd6-90755b6b552d">https://github.com/user-attachments/assets/ecdac8b8-d434-48b6-abd6-90755b6b552d</a></p> <p>Original repo: <a href="https://github.com/THUDM/CogVideo">https://github.com/THUDM/CogVideo</a></p> <p>CogVideoX-Fun: <a href="https://github.com/aigc-apps/CogVideoX-Fun">https://github.com/aigc-apps/CogVideoX-Fun</a></p> <p>Controlnet: <a href="https://github.com/TheDenk/cogvideox-controlnet">https://github.com/TheDenk/cogvideox-controlnet</a></p> \ No newline at end of file diff --git a/q%23/daily/index.xml b/q%23/daily/index.xml index 2bef0a9d46e..db8abfde5ed 100644 --- a/q%23/daily/index.xml +++ b/q%23/daily/index.xml @@ -1,7 +1,7 @@ GitHub Q# Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:40Z + 2024-12-10T01:36:32Z Daily Trending of Q# in GitHub \ No newline at end of file diff --git a/q/daily/index.xml b/q/daily/index.xml index b2d4500a05d..d9ac05d64fd 100644 --- a/q/daily/index.xml +++ b/q/daily/index.xml @@ -1,7 +1,7 @@ GitHub q Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:33Z + 2024-12-10T01:36:23Z Daily Trending of q in GitHub \ No newline at end of file diff --git a/qmake/daily/index.xml b/qmake/daily/index.xml index 42c40c8f33e..db4087a90d5 100644 --- a/qmake/daily/index.xml +++ b/qmake/daily/index.xml @@ -1,7 +1,7 @@ GitHub QMake Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:40Z + 2024-12-10T01:36:32Z Daily Trending of QMake in GitHub \ No newline at end of file diff --git a/qml/daily/index.xml b/qml/daily/index.xml index 82b78ed1a84..26c62214547 100644 --- a/qml/daily/index.xml +++ b/qml/daily/index.xml @@ -1,14 +1,7 @@ GitHub QML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:41Z + 2024-12-10T01:36:33Z Daily Trending of QML in GitHub - - yeyushengfan258/Win11OS-kde - 2024-12-09T01:34:41Z - tag:github.com,2024-12-09:/yeyushengfan258/Win11OS-kde - - <p>Win11OS kde is a materia Design theme for KDE Plasma desktop.</p><hr> - \ No newline at end of file diff --git a/qt-script/daily/index.xml b/qt-script/daily/index.xml index 15d1429d522..7cf529b3b2d 100644 --- a/qt-script/daily/index.xml +++ b/qt-script/daily/index.xml @@ -1,7 +1,7 @@ GitHub Qt Script Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:40Z + 2024-12-10T01:36:33Z Daily Trending of Qt Script in GitHub \ No newline at end of file diff --git a/quake/daily/index.xml b/quake/daily/index.xml index 95ae41d0ce0..093beb55b5c 100644 --- a/quake/daily/index.xml +++ b/quake/daily/index.xml @@ -1,7 +1,7 @@ GitHub Quake Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:41Z + 2024-12-10T01:36:34Z Daily Trending of Quake in GitHub \ No newline at end of file diff --git a/r/daily/index.xml b/r/daily/index.xml index de3149a834b..a4ed8bdeb6d 100644 --- a/r/daily/index.xml +++ b/r/daily/index.xml @@ -1,7 +1,7 @@ GitHub R Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:42Z + 2024-12-10T01:36:35Z Daily Trending of R in GitHub \ No newline at end of file diff --git a/racket/daily/index.xml b/racket/daily/index.xml index 9ee92e4d3ed..658bdeb9950 100644 --- a/racket/daily/index.xml +++ b/racket/daily/index.xml @@ -1,7 +1,7 @@ GitHub Racket Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:42Z + 2024-12-10T01:36:34Z Daily Trending of Racket in GitHub \ No newline at end of file diff --git a/ragel/daily/index.xml b/ragel/daily/index.xml index 0d9de9d936f..92c3e06e742 100644 --- a/ragel/daily/index.xml +++ b/ragel/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ragel Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:44Z + 2024-12-10T01:36:36Z Daily Trending of Ragel in GitHub \ No newline at end of file diff --git a/raku/daily/index.xml b/raku/daily/index.xml index b6b61257f40..96d812546fd 100644 --- a/raku/daily/index.xml +++ b/raku/daily/index.xml @@ -1,7 +1,7 @@ GitHub Raku Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:44Z + 2024-12-10T01:36:37Z Daily Trending of Raku in GitHub \ No newline at end of file diff --git a/raml/daily/index.xml b/raml/daily/index.xml index ef9ab1728cc..39997c6bb33 100644 --- a/raml/daily/index.xml +++ b/raml/daily/index.xml @@ -1,7 +1,7 @@ GitHub RAML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:45Z + 2024-12-10T01:36:36Z Daily Trending of RAML in GitHub \ No newline at end of file diff --git a/rascal/daily/index.xml b/rascal/daily/index.xml index acf6e5634d8..835ed7b9baf 100644 --- a/rascal/daily/index.xml +++ b/rascal/daily/index.xml @@ -1,7 +1,7 @@ GitHub Rascal Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:44Z + 2024-12-10T01:36:37Z Daily Trending of Rascal in GitHub \ No newline at end of file diff --git a/raw-token-data/daily/index.xml b/raw-token-data/daily/index.xml index 4edf00333f3..294a5395443 100644 --- a/raw-token-data/daily/index.xml +++ b/raw-token-data/daily/index.xml @@ -1,7 +1,7 @@ GitHub Raw token data Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:46Z + 2024-12-10T01:36:38Z Daily Trending of Raw token data in GitHub \ No newline at end of file diff --git a/rdoc/daily/index.xml b/rdoc/daily/index.xml index 7d9e34e01e7..9abfc7136b8 100644 --- a/rdoc/daily/index.xml +++ b/rdoc/daily/index.xml @@ -1,7 +1,7 @@ GitHub RDoc Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:45Z + 2024-12-10T01:36:38Z Daily Trending of RDoc in GitHub \ No newline at end of file diff --git a/readline-config/daily/index.xml b/readline-config/daily/index.xml index ad1a702d7bb..a05e305a2d8 100644 --- a/readline-config/daily/index.xml +++ b/readline-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub Readline Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:46Z + 2024-12-10T01:36:38Z Daily Trending of Readline Config in GitHub \ No newline at end of file diff --git a/realbasic/daily/index.xml b/realbasic/daily/index.xml index 678661b92b7..10e6e064dfc 100644 --- a/realbasic/daily/index.xml +++ b/realbasic/daily/index.xml @@ -1,7 +1,7 @@ GitHub REALbasic Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:47Z + 2024-12-10T01:36:39Z Daily Trending of REALbasic in GitHub \ No newline at end of file diff --git a/reason/daily/index.xml b/reason/daily/index.xml index 555c270f5f4..b9e5f053181 100644 --- a/reason/daily/index.xml +++ b/reason/daily/index.xml @@ -1,7 +1,7 @@ GitHub Reason Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:48Z + 2024-12-10T01:36:40Z Daily Trending of Reason in GitHub \ No newline at end of file diff --git a/rebol/daily/index.xml b/rebol/daily/index.xml index 78563ac1acf..f5aa40a6cd4 100644 --- a/rebol/daily/index.xml +++ b/rebol/daily/index.xml @@ -1,7 +1,7 @@ GitHub Rebol Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:47Z + 2024-12-10T01:36:39Z Daily Trending of Rebol in GitHub \ No newline at end of file diff --git a/record-jar/daily/index.xml b/record-jar/daily/index.xml index 83624b2c89a..dbbbeca616a 100644 --- a/record-jar/daily/index.xml +++ b/record-jar/daily/index.xml @@ -1,7 +1,7 @@ GitHub Record Jar Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:49Z + 2024-12-10T01:36:41Z Daily Trending of Record Jar in GitHub \ No newline at end of file diff --git a/red/daily/index.xml b/red/daily/index.xml index 60681010da0..fb945674bb9 100644 --- a/red/daily/index.xml +++ b/red/daily/index.xml @@ -1,7 +1,7 @@ GitHub Red Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:49Z + 2024-12-10T01:36:41Z Daily Trending of Red in GitHub \ No newline at end of file diff --git a/redcode/daily/index.xml b/redcode/daily/index.xml index 0963d283748..451103c7ef7 100644 --- a/redcode/daily/index.xml +++ b/redcode/daily/index.xml @@ -1,7 +1,7 @@ GitHub Redcode Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:49Z + 2024-12-10T01:36:41Z Daily Trending of Redcode in GitHub \ No newline at end of file diff --git a/redirect-rules/daily/index.xml b/redirect-rules/daily/index.xml index 1a5a97eec7c..83a42149f61 100644 --- a/redirect-rules/daily/index.xml +++ b/redirect-rules/daily/index.xml @@ -1,7 +1,7 @@ GitHub Redirect Rules Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:48Z + 2024-12-10T01:36:41Z Daily Trending of Redirect Rules in GitHub \ No newline at end of file diff --git a/regular-expression/daily/index.xml b/regular-expression/daily/index.xml index 6dfb14480a5..1a407b84aac 100644 --- a/regular-expression/daily/index.xml +++ b/regular-expression/daily/index.xml @@ -1,7 +1,7 @@ GitHub Regular Expression Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:50Z + 2024-12-10T01:36:42Z Daily Trending of Regular Expression in GitHub \ No newline at end of file diff --git a/ren'py/daily/index.xml b/ren'py/daily/index.xml index 4b05b8851ff..3ef11f7cb12 100644 --- a/ren'py/daily/index.xml +++ b/ren'py/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ren'Py Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:51Z + 2024-12-10T01:36:43Z Daily Trending of Ren'Py in GitHub \ No newline at end of file diff --git a/renderscript/daily/index.xml b/renderscript/daily/index.xml index 1e0796198fd..b100ef39904 100644 --- a/renderscript/daily/index.xml +++ b/renderscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub RenderScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:50Z + 2024-12-10T01:36:42Z Daily Trending of RenderScript in GitHub \ No newline at end of file diff --git a/rescript/daily/index.xml b/rescript/daily/index.xml index 67702576258..11af243e0e6 100644 --- a/rescript/daily/index.xml +++ b/rescript/daily/index.xml @@ -1,7 +1,7 @@ GitHub ReScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:51Z + 2024-12-10T01:36:43Z Daily Trending of ReScript in GitHub \ No newline at end of file diff --git a/restructuredtext/daily/index.xml b/restructuredtext/daily/index.xml index dd97c07c613..72a4a303c6b 100644 --- a/restructuredtext/daily/index.xml +++ b/restructuredtext/daily/index.xml @@ -1,7 +1,7 @@ GitHub reStructuredText Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:52Z + 2024-12-10T01:36:45Z Daily Trending of reStructuredText in GitHub \ No newline at end of file diff --git a/rexx/daily/index.xml b/rexx/daily/index.xml index 1104598077a..bcfd5b7ef62 100644 --- a/rexx/daily/index.xml +++ b/rexx/daily/index.xml @@ -1,7 +1,7 @@ GitHub REXX Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:52Z + 2024-12-10T01:36:44Z Daily Trending of REXX in GitHub \ No newline at end of file diff --git a/rich-text-format/daily/index.xml b/rich-text-format/daily/index.xml index e214966fd2f..27913a61aed 100644 --- a/rich-text-format/daily/index.xml +++ b/rich-text-format/daily/index.xml @@ -1,7 +1,7 @@ GitHub Rich Text Format Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:57Z + 2024-12-10T01:36:44Z Daily Trending of Rich Text Format in GitHub \ No newline at end of file diff --git a/ring/daily/index.xml b/ring/daily/index.xml index 28d6586741d..6a183c8773d 100644 --- a/ring/daily/index.xml +++ b/ring/daily/index.xml @@ -1,7 +1,7 @@ GitHub Ring Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:58Z + 2024-12-10T01:36:46Z Daily Trending of Ring in GitHub \ No newline at end of file diff --git a/riot/daily/index.xml b/riot/daily/index.xml index a6f83041b69..9d89fafb501 100644 --- a/riot/daily/index.xml +++ b/riot/daily/index.xml @@ -1,7 +1,7 @@ GitHub Riot Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:59Z + 2024-12-10T01:36:46Z Daily Trending of Riot in GitHub \ No newline at end of file diff --git a/rmarkdown/daily/index.xml b/rmarkdown/daily/index.xml index 99f23f6bf46..188c771b86b 100644 --- a/rmarkdown/daily/index.xml +++ b/rmarkdown/daily/index.xml @@ -1,7 +1,7 @@ GitHub RMarkdown Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:58Z + 2024-12-10T01:36:46Z Daily Trending of RMarkdown in GitHub \ No newline at end of file diff --git a/robotframework/daily/index.xml b/robotframework/daily/index.xml index ba2e0a1a9a6..de289465c37 100644 --- a/robotframework/daily/index.xml +++ b/robotframework/daily/index.xml @@ -1,7 +1,7 @@ GitHub RobotFramework Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:34:59Z + 2024-12-10T01:36:45Z Daily Trending of RobotFramework in GitHub \ No newline at end of file diff --git a/robots.txt/daily/index.xml b/robots.txt/daily/index.xml index 81c230e2c86..e34d9987130 100644 --- a/robots.txt/daily/index.xml +++ b/robots.txt/daily/index.xml @@ -1,7 +1,7 @@ GitHub robots.txt Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:00Z + 2024-12-10T01:36:48Z Daily Trending of robots.txt in GitHub \ No newline at end of file diff --git a/roff-manpage/daily/index.xml b/roff-manpage/daily/index.xml index 21500d3254b..f52b15c5339 100644 --- a/roff-manpage/daily/index.xml +++ b/roff-manpage/daily/index.xml @@ -1,7 +1,7 @@ GitHub Roff Manpage Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:00Z + 2024-12-10T01:36:47Z Daily Trending of Roff Manpage in GitHub \ No newline at end of file diff --git a/roff/daily/index.xml b/roff/daily/index.xml index 42f2d0d6fe7..087477e10ba 100644 --- a/roff/daily/index.xml +++ b/roff/daily/index.xml @@ -1,7 +1,7 @@ GitHub Roff Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:01Z + 2024-12-10T01:36:48Z Daily Trending of Roff in GitHub \ No newline at end of file diff --git a/rouge/daily/index.xml b/rouge/daily/index.xml index 88d373e8532..bfe67949a7b 100644 --- a/rouge/daily/index.xml +++ b/rouge/daily/index.xml @@ -1,7 +1,7 @@ GitHub Rouge Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:02Z + 2024-12-10T01:36:49Z Daily Trending of Rouge in GitHub \ No newline at end of file diff --git a/rpc/daily/index.xml b/rpc/daily/index.xml index 25ba78edf83..ee0a1963e56 100644 --- a/rpc/daily/index.xml +++ b/rpc/daily/index.xml @@ -1,7 +1,7 @@ GitHub RPC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:02Z + 2024-12-10T01:36:49Z Daily Trending of RPC in GitHub \ No newline at end of file diff --git a/rpgle/daily/index.xml b/rpgle/daily/index.xml index 9ec4fffa427..81181c3e148 100644 --- a/rpgle/daily/index.xml +++ b/rpgle/daily/index.xml @@ -1,7 +1,7 @@ GitHub RPGLE Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:03Z + 2024-12-10T01:36:50Z Daily Trending of RPGLE in GitHub \ No newline at end of file diff --git a/rpm-spec/daily/index.xml b/rpm-spec/daily/index.xml index 58cfb540a20..3645fb1c4bf 100644 --- a/rpm-spec/daily/index.xml +++ b/rpm-spec/daily/index.xml @@ -1,7 +1,7 @@ GitHub RPM Spec Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:04Z + 2024-12-10T01:36:51Z Daily Trending of RPM Spec in GitHub \ No newline at end of file diff --git a/ruby/daily/index.xml b/ruby/daily/index.xml index b00f6426133..417a907f5a3 100644 --- a/ruby/daily/index.xml +++ b/ruby/daily/index.xml @@ -1,7 +1,14 @@ GitHub Ruby Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:05Z + 2024-12-10T01:36:59Z Daily Trending of Ruby in GitHub + + instacart/makara + 2024-12-10T01:36:59Z + tag:github.com,2024-12-10:/instacart/makara + + <p>A Read-Write Proxy for Connections; Also provides an ActiveRecord adapter.</p><hr><p>We are looking for maintainers to oversee the support and development of Makara. We are no longer using Makara at Instacart and we are unable to dedicate the time and resources to maintain it.</p> <p>If you're interested in maintaining Makara, please respond to <a href="https://github.com/instacart/makara/issues/393">this issue</a></p> <h1>Makara</h1> <p><img src="https://github.com/instacart/makara/workflows/CI/badge.svg?sanitize=true" alt="Build Status"> <a href="https://badge.fury.io/rb/makara"><img src="https://badge.fury.io/rb/makara.svg?sanitize=true" alt="Gem Version"></a> <a href="https://codeclimate.com/repos/526886a7f3ea00679b00cae6/feed"><img src="https://codeclimate.com/repos/526886a7f3ea00679b00cae6/badges/7905f7a000492a1078f7/gpa.png" alt="Code Climate"></a></p> <p>Makara is generic primary/replica proxy. It handles the heavy lifting of managing, choosing, blacklisting, and cycling through connections. It comes with an ActiveRecord database adapter implementation.</p> <h2>Installation</h2> <p>Use the current version of the gem from <a href="https://rubygems.org/gems/makara">rubygems</a> in your <code>Gemfile</code>.</p> <pre><code class="language-ruby">gem 'makara' </code></pre> <h2>Basic Usage</h2> <p>If you're only interested in the ActiveRecord database adapter... <a href="https://raw.githubusercontent.com/instacart/makara/master/#activerecord-database-adapter">here you go.</a></p> <p>Makara provides a base proxy class which you should inherit from. Your proxy connection class should implement a <code>connection_for</code> instance method which will be provided with an individual configuration and expect a real connection back.</p> <pre><code class="language-ruby">class MyAwesomeSqlProxy &lt; ::Makara::Proxy def connection_for(config) ::Sql::Client.new(config) end end </code></pre> <p>Next, you need to decide which methods are proxied and which methods should be sent to all underlying connections:</p> <pre><code class="language-ruby"> # within MyAwesomeSqlProxy hijack_method :select, :ping send_to_all :connect, :reconnect, :disconnect, :clear_cache </code></pre> <p>Assuming you don't need to split requests between a primary and a replica, you're done. If you do need to, implement the <code>needs_primary?</code> method:</p> <pre><code class="language-ruby"> # within MyAwesomeSqlProxy def needs_primary?(method_name, args) return false if args.empty? sql = args.first sql !~ /^select/i end </code></pre> <p>This implementation will send any request not like "SELECT..." to a primary connection. There are more methods you can override and more control over blacklisting - check out the <a href="https://raw.githubusercontent.com/instacart/makara/master/lib/active_record/connection_adapters/makara_abstract_adapter.rb">makara database adapter</a> for examples of advanced usage.</p> <h3>Config Parsing</h3> <p>Makara comes with a config parser which will handle providing subconfigs to the <code>connection_for</code> method. Check out the ActiveRecord database.yml example below for more info.</p> <h3>Stickiness Context</h3> <p>Makara handles stickiness by keeping track of which proxies are stuck at any given moment. The context is basically a mapping of proxy ids to the timestamp until which they are stuck.</p> <p>To handle persistence of context across requests in a Rack app, makara provides a middleware. It lays a cookie named <code>_mkra_stck</code> which contains the current context. If the next request is executed before the cookie expires, that given context will be used. If something occurs which naturally requires the primary on the second request, the context is updated and stored again.</p> <h4>Stickiness Impact</h4> <p>When <code>sticky:true</code>, once a query as been sent to the primary, all queries for the rest of the request will also be sent to the primary. In addition, the cookie described above will be set client side with an expiration defined by time at end of original request + <code>primary_ttl</code>. As long as the cookie is valid, all requests will send queries to primary.</p> <p>When <code>sticky:false</code>, only queries that need to go to the primary will go there. Subsequent read queries in the same request will go to replicas.</p> <h4>Releasing stuck connections (clearing context)</h4> <p>If you need to clear the current context, releasing any stuck connections, all you have to do is:</p> <pre><code class="language-ruby">Makara::Context.release_all </code></pre> <p>You can also clear stuck connections for a specific proxy:</p> <pre><code class="language-ruby">Makara::Context.release(proxy_id) Makara::Context.release('mysql_main') Makara::Context.release('redis') ... </code></pre> <p>A context is local to the curent thread of execution. This will allow you to stick to the primary safely in a single thread in systems such as sidekiq, for instance.</p> <h4>Forcing Primary</h4> <p>If you need to force the primary in your app then you can simply invoke stick_to_primary! on your connection:</p> <pre><code class="language-ruby">persist = true # or false, it's true by default proxy.stick_to_primary!(persist) </code></pre> <p>It'll keep the proxy stuck to the primary for the current request, and if <code>persist = true</code> (default), it'll be also stored in the context for subsequent requests, keeping the proxy stuck up to the duration of <code>primary_ttl</code> configured for the proxy.</p> <h4>Skipping the Stickiness</h4> <p>If you're using the <code>sticky: true</code> configuration and you find yourself in a situation where you need to write information through the proxy but you don't want the context to be stuck to the primary, you should use a <code>without_sticking</code> block:</p> <pre><code class="language-ruby">proxy.without_sticking do # do my stuff that would normally cause the proxy to stick to the primary end </code></pre> <h3>Logging</h3> <p>You can set a logger instance to ::Makara::Logging::Logger.logger and Makara will log how it handles errors at the Proxy level.</p> <pre><code class="language-ruby">Makara::Logging::Logger.logger = ::Logger.new(STDOUT) </code></pre> <h2>ActiveRecord Database Adapter</h2> <p>So you've found yourself with an ActiveRecord-based project which is starting to get some traffic and you realize 95% of you DB load is from reads. Well you've come to the right spot. Makara is a great solution to break up that load not only between primary and replica but potentially multiple primaries and/or multiple replicas.</p> <p>By creating a makara database adapter which simply acts as a proxy we avoid any major complexity surrounding specific database implementations. The makara adapter doesn't care if the underlying connection is mysql, postgresql, etc it simply cares about the sql string being executed.</p> <h3>What goes where?</h3> <p>In general: Any <code>SELECT</code> statements will execute against your replica(s), anything else will go to the primary.</p> <p>There are some edge cases:</p> <ul> <li><code>SET</code> operations will be sent to all connections</li> <li>Execution of specific methods such as <code>connect!</code>, <code>disconnect!</code>, and <code>clear_cache!</code> are invoked on all underlying connections</li> <li>Calls inside a transaction will always be sent to the primary (otherwise changes from within the transaction could not be read back on most transaction isolation levels)</li> <li>Locking reads (e.g. <code>SELECT ... FOR UPDATE</code>) will always be sent to the primary</li> </ul> <h3>Errors / blacklisting</h3> <p>Whenever a node fails an operation due to a connection issue, it is blacklisted for the amount of time specified in your database.yml. After that amount of time has passed, the connection will begin receiving queries again. If all replica nodes are blacklisted, the primary connection will begin receiving read queries as if it were a replica. Once all nodes are blacklisted the error is raised to the application and all nodes are whitelisted.</p> <h3>Database.yml</h3> <p>Your database.yml should contain the following structure:</p> <pre><code class="language-yml">production: adapter: 'mysql2_makara' database: 'MyAppProduction' # any other standard AR configurations # add a makara subconfig makara: # optional id to identify the proxy with this configuration for stickiness id: mysql # the following are default values blacklist_duration: 5 primary_ttl: 5 primary_strategy: round_robin sticky: true # list your connections with the override values (they're merged into the top-level config) # be sure to provide the role if primary, role is assumed to be a replica if not provided connections: - role: primary host: primary.sql.host - role: replica host: replica1.sql.host - role: replica host: replica2.sql.host </code></pre> <p>Let's break this down a little bit. At the top level of your config you have the standard <code>adapter</code> choice. Currently the available adapters are listed in <a href="https://raw.githubusercontent.com/instacart/makara/master/lib/active_record/connection_adapters/">lib/active_record/connection_adapters/</a>. They are in the form of <code>#{db_type}_makara</code> where db_type is mysql, postgresql, etc.</p> <p>Following the adapter choice is all the standard configurations (host, port, retry, database, username, password, etc). With all the standard configurations provided, you can now provide the makara subconfig.</p> <p>The makara subconfig sets up the proxy with a few of its own options, then provides the connection list. The makara options are:</p> <ul> <li>id - an identifier for the proxy, used for sticky behaviour and context. The default is to use a MD5 hash of the configuration contents, so if you are setting <code>sticky</code> to true, it's a good idea to also set an <code>id</code>. Otherwise any stuck connections will be cleared if the configuration changes (as the default MD5 hash id would change as well)</li> <li>blacklist_duration - the number of seconds a node is blacklisted when a connection failure occurs</li> <li>disable_blacklist - do not blacklist node at any error, useful in case of one primary</li> <li>sticky - if a node should be stuck to once it's used during a specific context</li> <li>primary_ttl - how long the primary context is persisted. generally, this needs to be longer than any replication lag</li> <li>primary_strategy - use a different strategy for picking the "current" primary node: <code>failover</code> will try to keep the same one until it is blacklisted. The default is <code>round_robin</code> which will cycle through available ones.</li> <li>replica_strategy - use a different strategy for picking the "current" replica node: <code>failover</code> will try to keep the same one until it is blacklisted. The default is <code>round_robin</code> which will cycle through available ones.</li> <li>connection_error_matchers - array of custom error matchers you want to be handled gracefully by Makara (as in, errors matching these regexes will result in blacklisting the connection as opposed to raising directly).</li> </ul> <p>Connection definitions contain any extra node-specific configurations. If the node should behave as a primary you must provide <code>role: primary</code>. Any previous configurations can be overridden within a specific node's config. Nodes can also contain weights if you'd like to balance usage based on hardware specifications. Optionally, you can provide a name attribute which will be used in sql logging.</p> <pre><code class="language-yml">connections: - role: primary host: myprimary.sql.host blacklist_duration: 0 # implicit role: replica - host: mybigreplica.sql.host weight: 8 name: Big Replica - host: mysmallreplica.sql.host weight: 2 name: Small Replica </code></pre> <p>In the previous config the "Big Replica" would receive ~80% of traffic.</p> <h4>DATABASE_URL</h4> <p>Connections may specify a <code>url</code> parameter in place of host, username, password, etc.</p> <pre><code class="language-yml">connections: - role: primary blacklist_duration: 0 url: 'mysql2://db_username:db_password@localhost:3306/db_name' </code></pre> <p>We recommend, if using environmental variables, to interpolate them via ERb.</p> <pre><code class="language-yml">connections: - role: primary blacklist_duration: 0 url: &lt;%= ENV['DATABASE_URL_PRIMARY'] %&gt; - role: replica url: &lt;%= ENV['DATABASE_URL_REPLICA'] %&gt; </code></pre> <p><strong>Important</strong>: <em>Do NOT use <code>ENV['DATABASE_URL']</code></em>, as it inteferes with the the database configuration initialization and may cause Makara not to complete the configuration. For the moment, it is easier to use a different ENV variable than to hook into the database initialization in all the supported Rails.</p> <p>For more information on url parsing, as used in <a href="https://github.com/taskrabbit/makara/raw/master/lib/makara/config_parser.rb">ConfigParser</a>, see:</p> <ul> <li>3.0 <a href="https://github.com/rails/rails/raw/3-0-stable/activerecord/lib/active_record/connection_adapters/abstract/connection_specification.rb#L3-L7">ActiveRecord::Base::ConnectionSpecification.new</a></li> <li>3.0 <a href="https://github.com/rails/rails/raw/3-1-stable/activerecord/lib/active_record/connection_adapters/abstract/connection_specification.rb#L3-L7">ActiveRecord::Base::ConnectionSpecification.new</a></li> <li>3.2 <a href="https://github.com/rails/rails/raw/3-2-stable/activerecord/lib/active_record/connection_adapters/abstract/connection_specification.rb#L60-L77">ActiveRecord::Base::ConnectionSpecification::Resolver.send(:connection_url_to_hash, url_config[:url])</a></li> <li>4.0 <a href="https://github.com/rails/rails/raw/4-0-stable/activerecord/lib/active_record/connection_adapters/connection_specification.rb#L68-L92">ActiveRecord::ConnectionAdapters::ConnectionSpecification::Resolver.send(:connection_url_to_hash, url_config[:url])</a> <ul> <li><a href="https://github.com/rails/rails/raw/4-0-stable/activerecord/lib/active_record/connection_handling.rb">ActiveRecord::ConnectionHandling::MergeAndResolveDefaultUrlConfig</a></li> </ul> </li> <li>4.1 <a href="https://github.com/rails/rails/raw/4-1-stable/activerecord/lib/active_record/connection_adapters/connection_specification.rb#L17-L121">ActiveRecord::ConnectionAdapters::ConnectionSpecification::ConnectionUrlResolver.new(url).to_hash</a> <ul> <li>ActiveRecord::ConnectionHandling::MergeAndResolveDefaultUrlConfig.new(url_config).resolve</li> </ul> </li> <li>4.2 <a href="https://github.com/rails/rails/raw/4-2-stable/activerecord/lib/active_record/connection_handling.rb#L60-L81">ActiveRecord::ConnectionAdapters::ConnectionSpecification::ConnectionUrlResolver.new(url).to_hash</a></li> <li>primary <a href="https://github.com/rails/rails/raw/97b980b4e61aea3cee429bdee4b2eae2329905cd/activerecord/lib/active_record/connection_handling.rb#L60-L81">ActiveRecord::ConnectionAdapters::ConnectionSpecification::ConnectionUrlResolver.new(url).to_hash</a></li> </ul> <h2>Custom error matchers:</h2> <p>To enable Makara to catch and handle custom errors gracefully (blacklist the connection instead of raising directly), you must add your custom matchers to the <code>connection_error_matchers</code> setting of your config file, for example:</p> <pre><code class="language-yml">production: adapter: 'mysql2_makara' makara: blacklist_duration: 5 connection_error_matchers: - !ruby/regexp '/^ActiveRecord::StatementInvalid: Mysql2::Error: Unknown command:/' - '/Sql Server Has Gone Away/' - 'Mysql2::Error: Duplicate entry' </code></pre> <p>You can provide strings or regexes. In the case of strings, if they start with <code>/</code> and end with <code>/</code> they will be converted to regexes when evaluated. Strings that don't start and end with <code>/</code> will get evaluated with standard comparison.</p> <h2>Common Problems / Solutions</h2> <p>On occasion your app may deal with a situation where makara is not present during a write but a read should use primary. In the generic proxy details above you are encouraged to use <code>stick_to_primary!</code> to accomplish this. Here's an example:</p> <pre><code class="language-ruby"># some third party creates a resource in your db, replication may not have completed yet # ... # then your app is told to read the resource. def handle_request_after_third_party_record_creation CreatedResourceClass.connection.stick_to_primary! CreatedResourceClass.find(params[:id]) # will go to the primary end </code></pre> <h2>Todo</h2> <ul> <li>Support for providing context as query param</li> <li>More real world examples</li> </ul> + \ No newline at end of file diff --git a/runoff/daily/index.xml b/runoff/daily/index.xml index 21400a1d339..77f9e5c00d9 100644 --- a/runoff/daily/index.xml +++ b/runoff/daily/index.xml @@ -1,7 +1,7 @@ GitHub RUNOFF Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:03Z + 2024-12-10T01:36:50Z Daily Trending of RUNOFF in GitHub \ No newline at end of file diff --git a/rust/daily/index.xml b/rust/daily/index.xml index 127a97f9d0c..07ed72368db 100644 --- a/rust/daily/index.xml +++ b/rust/daily/index.xml @@ -1,7 +1,21 @@ GitHub Rust Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:11Z + 2024-12-10T01:37:05Z Daily Trending of Rust in GitHub + + katanemo/archgw + 2024-12-10T01:37:05Z + tag:github.com,2024-12-10:/katanemo/archgw + + <p>Arch is an intelligent gateway for agents. Engineered with (fast) LLMs for the secure handling, rich observability, and seamless integration of prompts with your APIs - all outside business logic. Built by the core contributors of Envoy proxy, on Envoy.</p><hr><p><img src="https://raw.githubusercontent.com/katanemo/archgw/main/docs/source/_static/img/arch-logo.png" alt="alt text"> <a href="https://www.producthunt.com/posts/arch-3?embed=true&amp;utm_source=badge-top-post-badge&amp;utm_medium=badge&amp;utm_souce=badge-arch-3" target="_blank"><img src="https://api.producthunt.com/widgets/embed-image/v1/top-post-badge.svg?post_id=565761&amp;theme=light&amp;period=daily" alt="Arch - Build fast, hyper-personalized agents with intelligent infra | Product Hunt" style="width: 250px; height: 54px;" width="250" height="54"></a></p> <p><a href="https://github.com/katanemo/arch/actions/workflows/pre-commit.yml"><img src="https://github.com/katanemo/arch/actions/workflows/pre-commit.yml/badge.svg?sanitize=true" alt="pre-commit"></a> <a href="https://github.com/katanemo/arch/actions/workflows/rust_tests.yml"><img src="https://github.com/katanemo/arch/actions/workflows/rust_tests.yml/badge.svg?sanitize=true" alt="rust tests (prompt and llm gateway)"></a> <a href="https://github.com/katanemo/arch/actions/workflows/e2e_tests.yml"><img src="https://github.com/katanemo/arch/actions/workflows/e2e_tests.yml/badge.svg?sanitize=true" alt="e2e tests"></a> <a href="https://github.com/katanemo/arch/actions/workflows/static.yml"><img src="https://github.com/katanemo/arch/actions/workflows/static.yml/badge.svg?sanitize=true" alt="Build and Deploy Documentation"></a></p> <h2>Build fast, observable, and personalized AI agents.</h2> <p>Arch is an intelligent <a href="https://www.cloudflare.com/learning/ddos/what-is-layer-7/">Layer 7</a> gateway designed to protect, observe, and personalize AI agents with your APIs.</p> <p>Engineered with purpose-built LLMs, Arch handles the critical but undifferentiated tasks related to the handling and processing of prompts, including detecting and rejecting <a href="https://github.com/verazuo/jailbreak_llms">jailbreak</a> attempts, intelligently calling "backend" APIs to fulfill the user's request represented in a prompt, routing to and offering disaster recovery between upstream LLMs, and managing the observability of prompts and LLM API calls in a centralized way.</p> <p>Arch is built on (and by the core contributors of) <a href="https://www.envoyproxy.io/">Envoy Proxy</a> with the belief that:</p> <blockquote> <p>Prompts are nuanced and opaque user requests, which require the same capabilities as traditional HTTP requests including secure handling, intelligent routing, robust observability, and integration with backend (API) systems for personalization – all outside business logic.*</p> </blockquote> <p><strong>Core Features</strong>:</p> <ul> <li>Built on <a href="https://envoyproxy.io">Envoy</a>: Arch runs alongside application servers as a separate containerized process, and builds on top of Envoy's proven HTTP management and scalability features to handle ingress and egress traffic related to prompts and LLMs.</li> <li>Function Calling for fast Agents and RAG apps. Engineered with purpose-built <a href="https://huggingface.co/collections/katanemo/arch-function-66f209a693ea8df14317ad68">LLMs</a> to handle fast, cost-effective, and accurate prompt-based tasks like function/API calling, and parameter extraction from prompts.</li> <li>Prompt <a href="https://huggingface.co/collections/katanemo/arch-guard-6702bdc08b889e4bce8f446d">Guard</a>: Arch centralizes guardrails to prevent jailbreak attempts and ensure safe user interactions without writing a single line of code.</li> <li>Routing &amp; Traffic Management: Arch manages LLM calls, offering smart retries, automatic cutover, and resilient upstream connections for continuous availability.</li> <li>Observability: Arch uses the W3C Trace Context standard to enable complete request tracing across applications, ensuring compatibility with observability tools, and provides metrics to monitor latency, token usage, and error rates, helping optimize AI application performance.</li> </ul> <p><strong>Jump to our <a href="https://docs.archgw.com">docs</a></strong> to learn how you can use Arch to improve the speed, security and personalization of your GenAI apps.</p> <blockquote> <p>[!IMPORTANT] Today, the function calling LLM (Arch-Function) designed for the agentic and RAG scenarios is hosted free of charge in the US-central region. To offer consistent latencies and throughput, and to manage our expenses, we will enable access to the hosted version via developers keys soon, and give you the option to run that LLM locally. For more details see this issue <a href="https://github.com/katanemo/archgw/issues/258">#258</a></p> </blockquote> <h2>Contact</h2> <p>To get in touch with us, please join our <a href="https://discord.gg/pGZf2gcwEc">discord server</a>. We will be monitoring that actively and offering support there.</p> <h2>Demos</h2> <ul> <li><a href="https://raw.githubusercontent.com/katanemo/archgw/main/demos/weather_forecast/README.md">Weather Forecast</a> - Walk through of the core function calling capabilities of arch gateway using weather forecasting service</li> <li><a href="https://raw.githubusercontent.com/katanemo/archgw/main/demos/insurance_agent/README.md">Insurance Agent</a> - Build a full insurance agent with Arch</li> <li><a href="https://raw.githubusercontent.com/katanemo/archgw/main/demos/network_agent/README.md">Network Agent</a> - Build a networking co-pilot/agent agent with Arch</li> </ul> <h2>Quickstart</h2> <p>Follow this quickstart guide to use arch gateway to build a simple AI agent. Laster in the section we will see how you can Arch Gateway to manage access keys, provide unified access to upstream LLMs and to provide e2e observability.</p> <h3>Prerequisites</h3> <p>Before you begin, ensure you have the following:</p> <ol> <li><a href="https://docs.docker.com/get-started/get-docker/">Docker System</a> (v24)</li> <li><a href="https://docs.docker.com/compose/install/">Docker compose</a> (v2.29)</li> <li><a href="https://www.python.org/downloads/">Python</a> (v3.12)</li> </ol> <p>Arch's CLI allows you to manage and interact with the Arch gateway efficiently. To install the CLI, simply run the following command:</p> <blockquote> <p>[!TIP] We recommend that developers create a new Python virtual environment to isolate dependencies before installing Arch. This ensures that archgw and its dependencies do not interfere with other packages on your system.</p> </blockquote> <pre><code class="language-console">$ python -m venv venv $ source venv/bin/activate # On Windows, use: venv\Scripts\activate $ pip install archgw==0.1.6 </code></pre> <h3>Build AI Agent with Arch Gateway</h3> <p>In following quickstart we will show you how easy it is to build AI agent with Arch gateway. We will build a currency exchange agent using following simple steps. For this demo we will use <code>https://api.frankfurter.dev/</code> to fetch latest price for currencies and assume USD as base currency.</p> <h4>Step 1. Create arch config file</h4> <p>Create <code>arch_config.yaml</code> file with following content,</p> <pre><code class="language-yaml">version: v0.1 listener: address: 0.0.0.0 port: 10000 message_format: huggingface connect_timeout: 0.005s llm_providers: - name: gpt-4o access_key: $OPENAI_API_KEY provider: openai model: gpt-4o system_prompt: | You are a helpful assistant. prompt_guards: input_guards: jailbreak: on_exception: message: Looks like you're curious about my abilities, but I can only provide assistance for currency exchange. prompt_targets: - name: currency_exchange description: Get currency exchange rate from USD to other currencies parameters: - name: currency_symbol description: the currency that needs conversion required: true type: str in_path: true endpoint: name: frankfurther_api path: /v1/latest?base=USD&amp;symbols={currency_symbol} system_prompt: | You are a helpful assistant. Show me the currency symbol you want to convert from USD. - name: get_supported_currencies description: Get list of supported currencies for conversion endpoint: name: frankfurther_api path: /v1/currencies endpoints: frankfurther_api: endpoint: api.frankfurter.dev:443 protocol: https </code></pre> <h4>Step 2. Start arch gateway with currency conversion config</h4> <pre><code class="language-sh"> $ archgw up arch_config.yaml 2024-12-05 16:56:27,979 - cli.main - INFO - Starting archgw cli version: 0.1.5 ... 2024-12-05 16:56:28,485 - cli.utils - INFO - Schema validation successful! 2024-12-05 16:56:28,485 - cli.main - INFO - Starging arch model server and arch gateway ... 2024-12-05 16:56:51,647 - cli.core - INFO - Container is healthy! </code></pre> <p>Once the gateway is up you can start interacting with at port 10000 using openai chat completion API.</p> <p>Some of the sample queries you can ask could be <code>what is currency rate for gbp?</code> or <code>show me list of currencies for conversion</code>.</p> <h4>Step 3. Interacting with gateway using curl command</h4> <p>Here is a sample curl command you can use to interact,</p> <pre><code class="language-bash">$ curl --header 'Content-Type: application/json' \ --data '{"messages": [{"role": "user","content": "what is exchange rate for gbp"}]}' \ http://localhost:10000/v1/chat/completions | jq ".choices[0].message.content" "As of the date provided in your context, December 5, 2024, the exchange rate for GBP (British Pound) from USD (United States Dollar) is 0.78558. This means that 1 USD is equivalent to 0.78558 GBP." </code></pre> <p>And to get list of supported currencies,</p> <pre><code class="language-bash">$ curl --header 'Content-Type: application/json' \ --data '{"messages": [{"role": "user","content": "show me list of currencies that are supported for conversion"}]}' \ http://localhost:10000/v1/chat/completions | jq ".choices[0].message.content" "Here is a list of the currencies that are supported for conversion from USD, along with their symbols:\n\n1. AUD - Australian Dollar\n2. BGN - Bulgarian Lev\n3. BRL - Brazilian Real\n4. CAD - Canadian Dollar\n5. CHF - Swiss Franc\n6. CNY - Chinese Renminbi Yuan\n7. CZK - Czech Koruna\n8. DKK - Danish Krone\n9. EUR - Euro\n10. GBP - British Pound\n11. HKD - Hong Kong Dollar\n12. HUF - Hungarian Forint\n13. IDR - Indonesian Rupiah\n14. ILS - Israeli New Sheqel\n15. INR - Indian Rupee\n16. ISK - Icelandic Króna\n17. JPY - Japanese Yen\n18. KRW - South Korean Won\n19. MXN - Mexican Peso\n20. MYR - Malaysian Ringgit\n21. NOK - Norwegian Krone\n22. NZD - New Zealand Dollar\n23. PHP - Philippine Peso\n24. PLN - Polish Złoty\n25. RON - Romanian Leu\n26. SEK - Swedish Krona\n27. SGD - Singapore Dollar\n28. THB - Thai Baht\n29. TRY - Turkish Lira\n30. USD - United States Dollar\n31. ZAR - South African Rand\n\nIf you want to convert USD to any of these currencies, you can select the one you are interested in." </code></pre> <h3>Use Arch Gateway as LLM Router</h3> <h4>Step 1. Create arch config file</h4> <p>Arch operates based on a configuration file where you can define LLM providers, prompt targets, guardrails, etc. Below is an example configuration that defines openai and mistral LLM providers.</p> <p>Create <code>arch_config.yaml</code> file with following content:</p> <pre><code class="language-yaml">version: v0.1 listener: address: 0.0.0.0 port: 10000 message_format: huggingface connect_timeout: 0.005s llm_providers: - name: gpt-4o access_key: $OPENAI_API_KEY provider: openai model: gpt-4o default: true - name: ministral-3b access_key: $MISTRAL_API_KEY provider: mistral model: ministral-3b-latest </code></pre> <h4>Step 2. Start arch gateway</h4> <p>Once the config file is created ensure that you have env vars setup for <code>MISTRAL_API_KEY</code> and <code>OPENAI_API_KEY</code> (or these are defined in <code>.env</code> file).</p> <p>Start arch gateway,</p> <pre><code>$ archgw up arch_config.yaml 2024-12-05 11:24:51,288 - cli.main - INFO - Starting archgw cli version: 0.1.5 2024-12-05 11:24:51,825 - cli.utils - INFO - Schema validation successful! 2024-12-05 11:24:51,825 - cli.main - INFO - Starting arch model server and arch gateway ... 2024-12-05 11:25:16,131 - cli.core - INFO - Container is healthy! </code></pre> <h3>Step 3: Interact with LLM</h3> <h4>Step 3.1: Using OpenAI python client</h4> <p>Make outbound calls via Arch gateway</p> <pre><code class="language-python">from openai import OpenAI # Use the OpenAI client as usual client = OpenAI( # No need to set a specific openai.api_key since it's configured in Arch's gateway api_key = '--', # Set the OpenAI API base URL to the Arch gateway endpoint base_url = "http://127.0.0.1:12000/v1" ) response = client.chat.completions.create( # we select model from arch_config file model="--", messages=[{"role": "user", "content": "What is the capital of France?"}], ) print("OpenAI Response:", response.choices[0].message.content) </code></pre> <h4>Step 3.2: Using curl command</h4> <pre><code>$ curl --header 'Content-Type: application/json' \ --data '{"messages": [{"role": "user","content": "What is the capital of France?"}]}' \ http://localhost:12000/v1/chat/completions { ... "model": "gpt-4o-2024-08-06", "choices": [ { ... "message": { "role": "assistant", "content": "The capital of France is Paris.", }, } ], ... } </code></pre> <p>You can override model selection using <code>x-arch-llm-provider-hint</code> header. For example if you want to use mistral using following curl command,</p> <pre><code>$ curl --header 'Content-Type: application/json' \ --header 'x-arch-llm-provider-hint: ministral-3b' \ --data '{"messages": [{"role": "user","content": "What is the capital of France?"}]}' \ http://localhost:12000/v1/chat/completions { ... "model": "ministral-3b-latest", "choices": [ { "message": { "role": "assistant", "content": "The capital of France is Paris. It is the most populous city in France and is known for its iconic landmarks such as the Eiffel Tower, the Louvre Museum, and Notre-Dame Cathedral. Paris is also a major global center for art, fashion, gastronomy, and culture.", }, ... } ], ... } </code></pre> <h2><a href="https://docs.archgw.com/guides/observability/observability.html">Observability</a></h2> <p>Arch is designed to support best-in class observability by supporting open standards. Please read our <a href="https://docs.archgw.com/guides/observability/observability.html">docs</a> on observability for more details on tracing, metrics, and logs. The screenshot below is from our integration with Signoz (among others)</p> <p><img src="https://raw.githubusercontent.com/katanemo/archgw/main/docs/source/_static/img/tracing.png" alt="alt text"></p> <h2>Contribution</h2> <p>We would love feedback on our <a href="https://github.com/orgs/katanemo/projects/1">Roadmap</a> and we welcome contributions to <strong>Arch</strong>! Whether you're fixing bugs, adding new features, improving documentation, or creating tutorials, your help is much appreciated. Please visit our <a href="https://raw.githubusercontent.com/katanemo/archgw/main/CONTRIBUTING.md">Contribution Guide</a> for more details</p> + + + woodruffw/zizmor + 2024-12-10T01:37:05Z + tag:github.com,2024-12-10:/woodruffw/zizmor + + <p>A static analysis tool for GitHub Actions</p><hr><h1>🌈 zizmor</h1> <p><a href="https://github.com/woodruffw/zizmor/actions/workflows/ci.yml"><img src="https://github.com/woodruffw/zizmor/actions/workflows/ci.yml/badge.svg?sanitize=true" alt="CI"></a> <a href="https://crates.io/crates/zizmor"><img src="https://img.shields.io/crates/v/zizmor" alt="Crates.io"></a> <a href="https://repology.org/project/zizmor/versions"><img src="https://repology.org/badge/tiny-repos/zizmor.svg?sanitize=true" alt="Packaging status"></a> <a href="https://github.com/sponsors/woodruffw"><img src="https://img.shields.io/github/sponsors/woodruffw?style=flat&amp;logo=githubsponsors&amp;labelColor=white&amp;color=white" alt="GitHub Sponsors"></a></p> <p><code>zizmor</code> is a static analysis tool for GitHub Actions. It can find many common security issues in typical GitHub Actions CI/CD setups.</p> <blockquote> <p>[!IMPORTANT] <code>zizmor</code> is currently in beta. You will encounter bugs; <a href="https://github.com/woodruffw/zizmor/issues/new?assignees=&amp;labels=bug%2Ctriage&amp;projects=&amp;template=bug-report.yml&amp;title=%5BBUG%5D%3A+">please file them</a>!</p> </blockquote> <p><img src="https://raw.githubusercontent.com/woodruffw/zizmor/main/docs/assets/zizmor-demo.gif" alt="zizmor demo"></p> <p>See <a href="https://woodruffw.github.io/zizmor/"><code>zizmor</code>'s documentation</a> for <a href="https://woodruffw.github.io/zizmor/installation/">installation steps</a>, as well as a <a href="https://woodruffw.github.io/zizmor/quickstart/">quickstart</a> and <a href="https://woodruffw.github.io/zizmor/usage/">detailed usage recipes</a>.</p> <h2>License</h2> <p><code>zizmor</code> is licensed under the <a href="https://raw.githubusercontent.com/woodruffw/zizmor/main/LICENSE">MIT License</a>.</p> <h2>Contributing</h2> <p>See <a href="https://raw.githubusercontent.com/woodruffw/zizmor/main/CONTRIBUTING.md">our contributing guide!</a></p> <h2>The name?</h2> <p><em><a href="https://www.youtube.com/watch?v=ol7rxFCvpy8">Now you can have beautiful clean workflows!</a></em></p> <h2>Star History</h2> <a href="https://star-history.com/#woodruffw/zizmor&amp;Date"> <picture> <source media="(prefers-color-scheme: dark)" srcset="https://api.star-history.com/svg?repos=woodruffw/zizmor&amp;type=Date&amp;theme=dark"> <source media="(prefers-color-scheme: light)" srcset="https://api.star-history.com/svg?repos=woodruffw/zizmor&amp;type=Date"> <img alt="Star History Chart" src="https://api.star-history.com/svg?repos=woodruffw/zizmor&amp;type=Date"> </picture> </a> + \ No newline at end of file diff --git a/sage/daily/index.xml b/sage/daily/index.xml index 8e364480e61..91e65217a5a 100644 --- a/sage/daily/index.xml +++ b/sage/daily/index.xml @@ -1,7 +1,7 @@ GitHub Sage Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:08Z + 2024-12-10T01:37:04Z Daily Trending of Sage in GitHub \ No newline at end of file diff --git a/saltstack/daily/index.xml b/saltstack/daily/index.xml index b47d3efd31e..9fa5b5f485b 100644 --- a/saltstack/daily/index.xml +++ b/saltstack/daily/index.xml @@ -1,7 +1,7 @@ GitHub SaltStack Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:08Z + 2024-12-10T01:37:03Z Daily Trending of SaltStack in GitHub \ No newline at end of file diff --git a/sas/daily/index.xml b/sas/daily/index.xml index 3ffbeb173fa..853ae526281 100644 --- a/sas/daily/index.xml +++ b/sas/daily/index.xml @@ -1,7 +1,7 @@ GitHub SAS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:08Z + 2024-12-10T01:37:03Z Daily Trending of SAS in GitHub \ No newline at end of file diff --git a/sass/daily/index.xml b/sass/daily/index.xml index 4413599c984..cf07359b473 100644 --- a/sass/daily/index.xml +++ b/sass/daily/index.xml @@ -1,7 +1,7 @@ GitHub Sass Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:18Z + 2024-12-10T01:37:11Z Daily Trending of Sass in GitHub \ No newline at end of file diff --git a/scala/daily/index.xml b/scala/daily/index.xml index b2c67064085..ee9a4f24d6b 100644 --- a/scala/daily/index.xml +++ b/scala/daily/index.xml @@ -1,14 +1,7 @@ GitHub Scala Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:19Z + 2024-12-10T01:37:13Z Daily Trending of Scala in GitHub - - NVIDIA/spark-rapids-tools - 2024-12-09T01:35:19Z - tag:github.com,2024-12-09:/NVIDIA/spark-rapids-tools - - <p>User tools for Spark RAPIDS</p><hr><h1>RAPIDS Accelerator for Apache Spark Tools</h1> <p>This repo provides the tools to use <a href="https://github.com/NVIDIA/spark-rapids">RAPIDS Accelerator for Apache Spark</a>.</p> <h2>Catalog</h2> <ul> <li><a href="https://raw.githubusercontent.com/NVIDIA/spark-rapids-tools/dev/core">RAPIDS core tools</a>: Tools that help developers getting the most out of their Apache Spark applications without any code change: <ul> <li>Report acceleration potential of RAPIDS Accelerator for Apache Spark on a set of Spark applications.</li> <li>Generate comprehensive profiling analysis for Apache Sparks executing on accelerated GPU instances. This information can be used to further tune and optimize the application.</li> </ul> </li> <li><a href="https://raw.githubusercontent.com/NVIDIA/spark-rapids-tools/dev/user_tools">spark-rapids-user-tools</a>: A simple wrapper process around cloud service providers to run <a href="https://raw.githubusercontent.com/NVIDIA/spark-rapids-tools/dev/core">RAPIDS core tools</a> across multiple cloud platforms. In addition, the output educates the users on the cost savings and acceleration potential of RAPIDS Accelerator for Apache Spark and makes recommendations to tune the application performance based on the cluster shape.</li> </ul> - \ No newline at end of file diff --git a/scaml/daily/index.xml b/scaml/daily/index.xml index 84cec70e359..966c88e3eb2 100644 --- a/scaml/daily/index.xml +++ b/scaml/daily/index.xml @@ -1,7 +1,7 @@ GitHub Scaml Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:17Z + 2024-12-10T01:37:11Z Daily Trending of Scaml in GitHub \ No newline at end of file diff --git a/scheme/daily/index.xml b/scheme/daily/index.xml index 17eebbfb193..13c7a0f1575 100644 --- a/scheme/daily/index.xml +++ b/scheme/daily/index.xml @@ -1,7 +1,7 @@ GitHub Scheme Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:23Z + 2024-12-10T01:37:16Z Daily Trending of Scheme in GitHub \ No newline at end of file diff --git a/scilab/daily/index.xml b/scilab/daily/index.xml index 1e3f8314bf5..b6327856ebc 100644 --- a/scilab/daily/index.xml +++ b/scilab/daily/index.xml @@ -1,7 +1,7 @@ GitHub Scilab Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:22Z + 2024-12-10T01:37:15Z Daily Trending of Scilab in GitHub \ No newline at end of file diff --git a/scss/daily/index.xml b/scss/daily/index.xml index 0d4fe0db4cd..f111501f1a4 100644 --- a/scss/daily/index.xml +++ b/scss/daily/index.xml @@ -1,7 +1,7 @@ GitHub SCSS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:24Z + 2024-12-10T01:37:16Z Daily Trending of SCSS in GitHub \ No newline at end of file diff --git a/sed/daily/index.xml b/sed/daily/index.xml index ecd65496b83..e9b6495346c 100644 --- a/sed/daily/index.xml +++ b/sed/daily/index.xml @@ -1,7 +1,7 @@ GitHub sed Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:22Z + 2024-12-10T01:37:15Z Daily Trending of sed in GitHub \ No newline at end of file diff --git a/self/daily/index.xml b/self/daily/index.xml index 331328daf49..806d9041540 100644 --- a/self/daily/index.xml +++ b/self/daily/index.xml @@ -1,7 +1,7 @@ GitHub Self Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:24Z + 2024-12-10T01:37:17Z Daily Trending of Self in GitHub \ No newline at end of file diff --git a/selinux-policy/daily/index.xml b/selinux-policy/daily/index.xml index 165037854c1..4eeec279d5b 100644 --- a/selinux-policy/daily/index.xml +++ b/selinux-policy/daily/index.xml @@ -1,7 +1,7 @@ GitHub SELinux Policy Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:24Z + 2024-12-10T01:37:17Z Daily Trending of SELinux Policy in GitHub \ No newline at end of file diff --git a/shaderlab/daily/index.xml b/shaderlab/daily/index.xml index 4dfbae5c73c..262832b63b1 100644 --- a/shaderlab/daily/index.xml +++ b/shaderlab/daily/index.xml @@ -1,7 +1,7 @@ GitHub ShaderLab Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:25Z + 2024-12-10T01:37:18Z Daily Trending of ShaderLab in GitHub \ No newline at end of file diff --git a/shell/daily/index.xml b/shell/daily/index.xml index 3f64870463e..2cb9639bdf6 100644 --- a/shell/daily/index.xml +++ b/shell/daily/index.xml @@ -1,7 +1,7 @@ GitHub Shell Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:26Z + 2024-12-10T01:37:19Z Daily Trending of Shell in GitHub \ No newline at end of file diff --git a/shellcheck-config/daily/index.xml b/shellcheck-config/daily/index.xml index da358e74a9d..d88cd7818aa 100644 --- a/shellcheck-config/daily/index.xml +++ b/shellcheck-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub ShellCheck Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:31Z + 2024-12-10T01:37:23Z Daily Trending of ShellCheck Config in GitHub \ No newline at end of file diff --git a/shellsession/daily/index.xml b/shellsession/daily/index.xml index f9a6f7d8edd..fe6b72a989f 100644 --- a/shellsession/daily/index.xml +++ b/shellsession/daily/index.xml @@ -1,7 +1,7 @@ GitHub ShellSession Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:30Z + 2024-12-10T01:37:23Z Daily Trending of ShellSession in GitHub \ No newline at end of file diff --git a/shen/daily/index.xml b/shen/daily/index.xml index 1c80ffc511d..b518f41f974 100644 --- a/shen/daily/index.xml +++ b/shen/daily/index.xml @@ -1,7 +1,7 @@ GitHub Shen Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:31Z + 2024-12-10T01:37:22Z Daily Trending of Shen in GitHub \ No newline at end of file diff --git a/sieve/daily/index.xml b/sieve/daily/index.xml index 24a283abad3..f2913744846 100644 --- a/sieve/daily/index.xml +++ b/sieve/daily/index.xml @@ -1,7 +1,7 @@ GitHub Sieve Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:30Z + 2024-12-10T01:37:23Z Daily Trending of Sieve in GitHub \ No newline at end of file diff --git a/singularity/daily/index.xml b/singularity/daily/index.xml index 605c4d757e9..11ae0e348ec 100644 --- a/singularity/daily/index.xml +++ b/singularity/daily/index.xml @@ -1,7 +1,7 @@ GitHub Singularity Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:32Z + 2024-12-10T01:37:24Z Daily Trending of Singularity in GitHub \ No newline at end of file diff --git a/slash/daily/index.xml b/slash/daily/index.xml index 97cf5a2ec2a..7e0b70db76e 100644 --- a/slash/daily/index.xml +++ b/slash/daily/index.xml @@ -1,7 +1,7 @@ GitHub Slash Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:32Z + 2024-12-10T01:37:25Z Daily Trending of Slash in GitHub \ No newline at end of file diff --git a/slice/daily/index.xml b/slice/daily/index.xml index 1e3da046a6c..0c5988c3d84 100644 --- a/slice/daily/index.xml +++ b/slice/daily/index.xml @@ -1,7 +1,7 @@ GitHub Slice Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:33Z + 2024-12-10T01:37:25Z Daily Trending of Slice in GitHub \ No newline at end of file diff --git a/slim/daily/index.xml b/slim/daily/index.xml index 230b2bac7c8..c3f65731546 100644 --- a/slim/daily/index.xml +++ b/slim/daily/index.xml @@ -1,7 +1,7 @@ GitHub Slim Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:33Z + 2024-12-10T01:37:26Z Daily Trending of Slim in GitHub \ No newline at end of file diff --git a/smali/daily/index.xml b/smali/daily/index.xml index be60a18fa04..518a02b1948 100644 --- a/smali/daily/index.xml +++ b/smali/daily/index.xml @@ -1,7 +1,7 @@ GitHub Smali Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:34Z + 2024-12-10T01:37:27Z Daily Trending of Smali in GitHub \ No newline at end of file diff --git a/smalltalk/daily/index.xml b/smalltalk/daily/index.xml index 28821170b88..e4723bb9857 100644 --- a/smalltalk/daily/index.xml +++ b/smalltalk/daily/index.xml @@ -1,7 +1,7 @@ GitHub Smalltalk Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:34Z + 2024-12-10T01:37:26Z Daily Trending of Smalltalk in GitHub \ No newline at end of file diff --git a/smarty/daily/index.xml b/smarty/daily/index.xml index 233381301b6..df7fdfb6af5 100644 --- a/smarty/daily/index.xml +++ b/smarty/daily/index.xml @@ -1,7 +1,7 @@ GitHub Smarty Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:37Z + 2024-12-10T01:37:28Z Daily Trending of Smarty in GitHub \ No newline at end of file diff --git a/smpl/daily/index.xml b/smpl/daily/index.xml index c0bc050d636..1c42cfb3c60 100644 --- a/smpl/daily/index.xml +++ b/smpl/daily/index.xml @@ -1,7 +1,7 @@ GitHub SmPL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:35Z + 2024-12-10T01:37:27Z Daily Trending of SmPL in GitHub \ No newline at end of file diff --git a/smt/daily/index.xml b/smt/daily/index.xml index a571419e8ed..7cff86db8fb 100644 --- a/smt/daily/index.xml +++ b/smt/daily/index.xml @@ -1,7 +1,7 @@ GitHub SMT Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:36Z + 2024-12-10T01:37:29Z Daily Trending of SMT in GitHub \ No newline at end of file diff --git a/solidity/daily/index.xml b/solidity/daily/index.xml index 739e413d972..7a9927f9101 100644 --- a/solidity/daily/index.xml +++ b/solidity/daily/index.xml @@ -1,7 +1,7 @@ GitHub Solidity Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:39Z + 2024-12-10T01:37:31Z Daily Trending of Solidity in GitHub \ No newline at end of file diff --git a/soong/daily/index.xml b/soong/daily/index.xml index b7638932e07..e1d6f0963a5 100644 --- a/soong/daily/index.xml +++ b/soong/daily/index.xml @@ -1,7 +1,7 @@ GitHub Soong Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:38Z + 2024-12-10T01:37:30Z Daily Trending of Soong in GitHub \ No newline at end of file diff --git a/sourcepawn/daily/index.xml b/sourcepawn/daily/index.xml index d3f8d46cf7f..20841a53c89 100644 --- a/sourcepawn/daily/index.xml +++ b/sourcepawn/daily/index.xml @@ -1,7 +1,7 @@ GitHub SourcePawn Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:38Z + 2024-12-10T01:37:30Z Daily Trending of SourcePawn in GitHub \ No newline at end of file diff --git a/sparql/daily/index.xml b/sparql/daily/index.xml index c96c1bea921..fae4aa0c965 100644 --- a/sparql/daily/index.xml +++ b/sparql/daily/index.xml @@ -1,7 +1,7 @@ GitHub SPARQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:40Z + 2024-12-10T01:37:32Z Daily Trending of SPARQL in GitHub \ No newline at end of file diff --git a/spline-font-database/daily/index.xml b/spline-font-database/daily/index.xml index 6248ea33bdd..08abaeb2a0f 100644 --- a/spline-font-database/daily/index.xml +++ b/spline-font-database/daily/index.xml @@ -1,7 +1,7 @@ GitHub Spline Font Database Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:39Z + 2024-12-10T01:37:32Z Daily Trending of Spline Font Database in GitHub \ No newline at end of file diff --git a/sqf/daily/index.xml b/sqf/daily/index.xml index c8a1d07e41f..007575ba742 100644 --- a/sqf/daily/index.xml +++ b/sqf/daily/index.xml @@ -1,7 +1,7 @@ GitHub SQF Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:40Z + 2024-12-10T01:37:32Z Daily Trending of SQF in GitHub \ No newline at end of file diff --git a/sql/daily/index.xml b/sql/daily/index.xml index 9a66d664af6..8904f647786 100644 --- a/sql/daily/index.xml +++ b/sql/daily/index.xml @@ -1,7 +1,7 @@ GitHub SQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:40Z + 2024-12-10T01:37:32Z Daily Trending of SQL in GitHub \ No newline at end of file diff --git a/sqlpl/daily/index.xml b/sqlpl/daily/index.xml index 5923672329d..d6c8e03b8d0 100644 --- a/sqlpl/daily/index.xml +++ b/sqlpl/daily/index.xml @@ -1,7 +1,7 @@ GitHub SQLPL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:42Z + 2024-12-10T01:37:34Z Daily Trending of SQLPL in GitHub \ No newline at end of file diff --git a/squirrel/daily/index.xml b/squirrel/daily/index.xml index 12fdd418bad..786fe1c0616 100644 --- a/squirrel/daily/index.xml +++ b/squirrel/daily/index.xml @@ -1,7 +1,7 @@ GitHub Squirrel Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:41Z + 2024-12-10T01:37:33Z Daily Trending of Squirrel in GitHub \ No newline at end of file diff --git a/srecode-template/daily/index.xml b/srecode-template/daily/index.xml index ec41d7d3393..6ca87f0ab47 100644 --- a/srecode-template/daily/index.xml +++ b/srecode-template/daily/index.xml @@ -1,7 +1,7 @@ GitHub SRecode Template Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:41Z + 2024-12-10T01:37:34Z Daily Trending of SRecode Template in GitHub \ No newline at end of file diff --git a/ssh-config/daily/index.xml b/ssh-config/daily/index.xml index cffdff253a1..ccd2052d8df 100644 --- a/ssh-config/daily/index.xml +++ b/ssh-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub SSH Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:42Z + 2024-12-10T01:37:33Z Daily Trending of SSH Config in GitHub \ No newline at end of file diff --git a/stan/daily/index.xml b/stan/daily/index.xml index e8dc5b362cb..a2b15c9e150 100644 --- a/stan/daily/index.xml +++ b/stan/daily/index.xml @@ -1,7 +1,7 @@ GitHub Stan Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:43Z + 2024-12-10T01:37:35Z Daily Trending of Stan in GitHub \ No newline at end of file diff --git a/standard-ml/daily/index.xml b/standard-ml/daily/index.xml index e4c35021c8a..1665fbeb6f9 100644 --- a/standard-ml/daily/index.xml +++ b/standard-ml/daily/index.xml @@ -1,7 +1,7 @@ GitHub Standard ML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:43Z + 2024-12-10T01:37:35Z Daily Trending of Standard ML in GitHub \ No newline at end of file diff --git a/starlark/daily/index.xml b/starlark/daily/index.xml index 83915253cdb..c3bdb981e74 100644 --- a/starlark/daily/index.xml +++ b/starlark/daily/index.xml @@ -1,7 +1,7 @@ GitHub Starlark Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:45Z + 2024-12-10T01:37:37Z Daily Trending of Starlark in GitHub \ No newline at end of file diff --git a/stata/daily/index.xml b/stata/daily/index.xml index ca6e0b4698f..36d74090571 100644 --- a/stata/daily/index.xml +++ b/stata/daily/index.xml @@ -1,7 +1,7 @@ GitHub Stata Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:46Z + 2024-12-10T01:37:39Z Daily Trending of Stata in GitHub \ No newline at end of file diff --git a/ston/daily/index.xml b/ston/daily/index.xml index c66c2774b79..977e3f002ae 100644 --- a/ston/daily/index.xml +++ b/ston/daily/index.xml @@ -1,7 +1,7 @@ GitHub STON Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:45Z + 2024-12-10T01:37:38Z Daily Trending of STON in GitHub \ No newline at end of file diff --git a/stringtemplate/daily/index.xml b/stringtemplate/daily/index.xml index 43e5264f05c..6092045d086 100644 --- a/stringtemplate/daily/index.xml +++ b/stringtemplate/daily/index.xml @@ -1,7 +1,7 @@ GitHub StringTemplate Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:46Z + 2024-12-10T01:37:38Z Daily Trending of StringTemplate in GitHub \ No newline at end of file diff --git a/stylus/daily/index.xml b/stylus/daily/index.xml index 1004c6c83aa..8c863dc7f29 100644 --- a/stylus/daily/index.xml +++ b/stylus/daily/index.xml @@ -1,7 +1,7 @@ GitHub Stylus Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:48Z + 2024-12-10T01:37:40Z Daily Trending of Stylus in GitHub \ No newline at end of file diff --git a/subrip-text/daily/index.xml b/subrip-text/daily/index.xml index 3e9570ef1e3..008f3628107 100644 --- a/subrip-text/daily/index.xml +++ b/subrip-text/daily/index.xml @@ -1,7 +1,7 @@ GitHub SubRip Text Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:47Z + 2024-12-10T01:37:40Z Daily Trending of SubRip Text in GitHub \ No newline at end of file diff --git a/sugarss/daily/index.xml b/sugarss/daily/index.xml index b312ab32bab..86e0d9a807c 100644 --- a/sugarss/daily/index.xml +++ b/sugarss/daily/index.xml @@ -1,7 +1,7 @@ GitHub SugarSS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:48Z + 2024-12-10T01:37:40Z Daily Trending of SugarSS in GitHub \ No newline at end of file diff --git a/supercollider/daily/index.xml b/supercollider/daily/index.xml index 04c440bee06..a4188439544 100644 --- a/supercollider/daily/index.xml +++ b/supercollider/daily/index.xml @@ -1,7 +1,7 @@ GitHub SuperCollider Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:47Z + 2024-12-10T01:37:39Z Daily Trending of SuperCollider in GitHub \ No newline at end of file diff --git a/svelte/daily/index.xml b/svelte/daily/index.xml index 0b59377c0d0..edcca0cb6b6 100644 --- a/svelte/daily/index.xml +++ b/svelte/daily/index.xml @@ -1,7 +1,7 @@ GitHub Svelte Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:50Z + 2024-12-10T01:37:43Z Daily Trending of Svelte in GitHub \ No newline at end of file diff --git a/svg/daily/index.xml b/svg/daily/index.xml index ee92e8d93e8..a4b82cae82d 100644 --- a/svg/daily/index.xml +++ b/svg/daily/index.xml @@ -1,7 +1,7 @@ GitHub SVG Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:50Z + 2024-12-10T01:37:42Z Daily Trending of SVG in GitHub \ No newline at end of file diff --git a/swift/daily/index.xml b/swift/daily/index.xml index fef985cdadb..07f414f2c6a 100644 --- a/swift/daily/index.xml +++ b/swift/daily/index.xml @@ -1,7 +1,14 @@ GitHub Swift Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:54Z + 2024-12-10T01:37:46Z Daily Trending of Swift in GitHub + + pmusolino/Wormholy + 2024-12-10T01:37:46Z + tag:github.com,2024-12-10:/pmusolino/Wormholy + + <p>iOS network debugging, like a wizard 🧙‍♂️</p><hr><p align="center"> <img src="https://raw.githubusercontent.com/pmusolino/Wormholy/master/logo.png" alt="Icon"> </p> <p><a href=""><img src="https://img.shields.io/badge/Swift-5-orange.svg?sanitize=true" alt="Language"></a> <a href="https://cocoapods.org/pods/Wormholy"><img src="https://img.shields.io/badge/Cocoapods-Compatible%20-blue" alt="Pod version"></a> <a href="https://swift.org/package-manager/"><img src="https://img.shields.io/badge/SPM-Compatible-green.svg?sanitize=true" alt="SPM Compatible"></a></p> <p>Start debugging iOS network calls like a wizard, without extra code! Wormholy makes debugging quick and reliable.</p> <p><strong>Features:</strong></p> <ul> <li><input type="checkbox" checked disabled> No code to write and no imports.</li> <li><input type="checkbox" checked disabled> Record all app traffic that uses <code>NSURLSession</code>.</li> <li><input type="checkbox" checked disabled> Reveal the content of all requests, responses, and headers simply by shaking your phone!</li> <li><input type="checkbox" checked disabled> No headaches with SSL certificates on HTTPS calls.</li> <li><input type="checkbox" checked disabled> Find, isolate, and fix bugs quickly.</li> <li><input type="checkbox" checked disabled> Swift &amp; Objective-C compatibility.</li> <li><input type="checkbox" checked disabled> Also works with external libraries like <code>Alamofire</code> &amp; <code>AFNetworking</code>.</li> <li><input type="checkbox" checked disabled> Ability to blacklist hosts from being recorded using the array <code>ignoredHosts</code>.</li> <li><input type="checkbox" checked disabled> Ability to export API requests as a Postman collection.</li> <li><input type="checkbox" checked disabled> Ability to share cURL representations of API requests.</li> <li><input type="checkbox" checked disabled> Programmatically enable or disable Wormholy for specific session configurations.</li> <li><input type="checkbox" checked disabled> Control the shake gesture activation with the <code>shakeEnabled</code> property.</li> <li><input type="checkbox" checked disabled> Filter responses by status code for precise debugging.</li> <li><input type="checkbox" checked disabled> View request stats, including HTTP methods breakdown, status code distribution, error types, response size stats, and more.</li> </ul> <p align="center"> <img src="https://raw.githubusercontent.com/pmusolino/Wormholy/refs/heads/feat/swift-ui-ios-15-support/screens.webp" alt="Screens"> </p> <h2>Requirements</h2> <ul> <li>iOS 16.0+</li> <li>Xcode 15+</li> <li>Swift 5</li> </ul> <h2>Usage</h2> <p>Integrating Wormholy into your project is simple, and it works like magic! <strong>Shake your device</strong> or simulator to access Wormholy. There's no need to import the library into your code.</p> <p><u><strong>It is recommended to install it only in debug mode and not integrate it into production. Please remove it before sending your apps to production.</strong></u> The easiest way to do this is with CocoaPods:</p> <pre><code class="language-shell">pod 'Wormholy', :configurations =&gt; ['Debug'] </code></pre> <p>You can also integrate Wormholy using the <strong>Swift Package Manager</strong>!</p> <h3>Configuration Options</h3> <ul> <li><strong>Ignored Hosts</strong>: Specify hosts to be excluded from logging using <code>Wormholy.ignoredHosts</code>. This is useful for ignoring traffic to certain domains.</li> <li><strong>Logging Limit</strong>: Control the number of logs retained with <code>Wormholy.limit</code>. This helps manage memory usage by limiting the amount of data stored.</li> <li><strong>Default Filter</strong>: Set a default filter for the search box with <code>Wormholy.defaultFilter</code> to streamline your debugging process.</li> <li><strong>Enable/Disable</strong>: Use <code>Wormholy.setEnabled(_:)</code> to toggle request tracking globally. You can also enable or disable it for specific <code>URLSessionConfiguration</code> instances using <code>Wormholy.setEnabled(_:sessionConfiguration:)</code>.</li> <li><strong>Shake Gesture</strong>: Control the activation of Wormholy via shake gesture with <code>Wormholy.shakeEnabled</code>.</li> </ul> <h3>Triggering Wormholy</h3> <p>If you prefer not to use the shake gesture, you can disable it using the <a href="https://medium.com/@derrickho_28266/xcode-custom-environment-variables-681b5b8674ec">environment variable</a> <code>WORMHOLY_SHAKE_ENABLED</code> = <code>NO</code>.</p> <p>To trigger Wormholy manually from another point in your app without using the shake gesture, call:</p> <pre><code class="language-swift">NotificationCenter.default.post(name: NSNotification.Name(rawValue: "wormholy_fire"), object: nil) </code></pre> <p>By following these steps and configurations, you can effectively integrate Wormholy into your development workflow, enhancing your ability to debug network requests efficiently.</p> <h2>Contributing</h2> <ul> <li>If you <strong>need help</strong> or you'd like to <strong>ask a general question</strong>, open an issue.</li> <li>If you <strong>found a bug</strong>, open an issue.</li> <li>If you <strong>have a feature request</strong>, open an issue.</li> <li>If you <strong>want to contribute</strong>, submit a pull request.</li> </ul> <h2>Acknowledgements</h2> <p><strong>Made with ❤️ by <a href="https://github.com/pmusolino">Paolo Musolino</a>.</strong></p> <p><em><strong>Follow me on:</strong></em></p> <h4>💼 <a href="https://www.linkedin.com/in/paolomusolino/">LinkedIn</a></h4> <h4>🤖 <a href="https://x.com/pmusolino">X</a></h4> <h2>MIT License</h2> <p>Wormholy is available under the MIT license. See the LICENSE file for more information.</p> + \ No newline at end of file diff --git a/swig/daily/index.xml b/swig/daily/index.xml index 09272d3e2db..8f6d8c283d5 100644 --- a/swig/daily/index.xml +++ b/swig/daily/index.xml @@ -1,7 +1,7 @@ GitHub SWIG Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:51Z + 2024-12-10T01:37:44Z Daily Trending of SWIG in GitHub \ No newline at end of file diff --git a/systemverilog/daily/index.xml b/systemverilog/daily/index.xml index 97ab2c675ba..fe7fdc9e0fe 100644 --- a/systemverilog/daily/index.xml +++ b/systemverilog/daily/index.xml @@ -1,7 +1,7 @@ GitHub SystemVerilog Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:52Z + 2024-12-10T01:37:46Z Daily Trending of SystemVerilog in GitHub \ No newline at end of file diff --git a/talon/daily/index.xml b/talon/daily/index.xml index 52df62db172..c4d278f4ccc 100644 --- a/talon/daily/index.xml +++ b/talon/daily/index.xml @@ -1,7 +1,7 @@ GitHub Talon Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:57Z + 2024-12-10T01:37:52Z Daily Trending of Talon in GitHub \ No newline at end of file diff --git a/tcl/daily/index.xml b/tcl/daily/index.xml index 4426fe598d6..7c1adcede38 100644 --- a/tcl/daily/index.xml +++ b/tcl/daily/index.xml @@ -1,7 +1,7 @@ GitHub Tcl Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:58Z + 2024-12-10T01:37:52Z Daily Trending of Tcl in GitHub \ No newline at end of file diff --git a/tcsh/daily/index.xml b/tcsh/daily/index.xml index f66c38c5481..85368834d4e 100644 --- a/tcsh/daily/index.xml +++ b/tcsh/daily/index.xml @@ -1,7 +1,7 @@ GitHub Tcsh Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:57Z + 2024-12-10T01:37:52Z Daily Trending of Tcsh in GitHub \ No newline at end of file diff --git a/tea/daily/index.xml b/tea/daily/index.xml index 2ca00b6642c..e6a1c618de1 100644 --- a/tea/daily/index.xml +++ b/tea/daily/index.xml @@ -1,7 +1,7 @@ GitHub Tea Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:57Z + 2024-12-10T01:37:51Z Daily Trending of Tea in GitHub \ No newline at end of file diff --git a/terra/daily/index.xml b/terra/daily/index.xml index cfc68edbd48..64e6c9acf0c 100644 --- a/terra/daily/index.xml +++ b/terra/daily/index.xml @@ -1,7 +1,7 @@ GitHub Terra Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:35:59Z + 2024-12-10T01:37:53Z Daily Trending of Terra in GitHub \ No newline at end of file diff --git a/tex/daily/index.xml b/tex/daily/index.xml index 551ec113081..cce006f959b 100644 --- a/tex/daily/index.xml +++ b/tex/daily/index.xml @@ -1,7 +1,7 @@ GitHub TeX Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:00Z + 2024-12-10T01:37:55Z Daily Trending of TeX in GitHub \ No newline at end of file diff --git a/texinfo/daily/index.xml b/texinfo/daily/index.xml index 02880d805c8..886438ad721 100644 --- a/texinfo/daily/index.xml +++ b/texinfo/daily/index.xml @@ -1,7 +1,7 @@ GitHub Texinfo Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:04Z + 2024-12-10T01:38:02Z Daily Trending of Texinfo in GitHub \ No newline at end of file diff --git a/text/daily/index.xml b/text/daily/index.xml index e596d1cf03a..6f836e97004 100644 --- a/text/daily/index.xml +++ b/text/daily/index.xml @@ -1,7 +1,7 @@ GitHub Text Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:03Z + 2024-12-10T01:38:02Z Daily Trending of Text in GitHub \ No newline at end of file diff --git a/textile/daily/index.xml b/textile/daily/index.xml index b729dd3cb47..e5477c1cf8e 100644 --- a/textile/daily/index.xml +++ b/textile/daily/index.xml @@ -1,7 +1,7 @@ GitHub Textile Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:02Z + 2024-12-10T01:38:02Z Daily Trending of Textile in GitHub \ No newline at end of file diff --git a/textmate-properties/daily/index.xml b/textmate-properties/daily/index.xml index eb386471936..08b995400d8 100644 --- a/textmate-properties/daily/index.xml +++ b/textmate-properties/daily/index.xml @@ -1,7 +1,7 @@ GitHub TextMate Properties Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:05Z + 2024-12-10T01:38:03Z Daily Trending of TextMate Properties in GitHub \ No newline at end of file diff --git a/thrift/daily/index.xml b/thrift/daily/index.xml index 9cd067cc45f..cb2c9a12f18 100644 --- a/thrift/daily/index.xml +++ b/thrift/daily/index.xml @@ -1,7 +1,7 @@ GitHub Thrift Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:05Z + 2024-12-10T01:38:04Z Daily Trending of Thrift in GitHub \ No newline at end of file diff --git a/ti-program/daily/index.xml b/ti-program/daily/index.xml index abdd596a336..1d3ccab89e1 100644 --- a/ti-program/daily/index.xml +++ b/ti-program/daily/index.xml @@ -1,7 +1,7 @@ GitHub TI Program Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:04Z + 2024-12-10T01:38:04Z Daily Trending of TI Program in GitHub \ No newline at end of file diff --git a/tla/daily/index.xml b/tla/daily/index.xml index d189bba7813..ec746796ed0 100644 --- a/tla/daily/index.xml +++ b/tla/daily/index.xml @@ -1,7 +1,7 @@ GitHub TLA Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:06Z + 2024-12-10T01:38:06Z Daily Trending of TLA in GitHub \ No newline at end of file diff --git a/toml/daily/index.xml b/toml/daily/index.xml index 72a6cb11831..46d94bd560e 100644 --- a/toml/daily/index.xml +++ b/toml/daily/index.xml @@ -1,7 +1,7 @@ GitHub TOML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:07Z + 2024-12-10T01:38:05Z Daily Trending of TOML in GitHub \ No newline at end of file diff --git a/tsql/daily/index.xml b/tsql/daily/index.xml index d3a5a82cd8e..dbc36145da5 100644 --- a/tsql/daily/index.xml +++ b/tsql/daily/index.xml @@ -1,7 +1,7 @@ GitHub TSQL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:08Z + 2024-12-10T01:38:07Z Daily Trending of TSQL in GitHub \ No newline at end of file diff --git a/tsv/daily/index.xml b/tsv/daily/index.xml index 92208f15010..97c6f269035 100644 --- a/tsv/daily/index.xml +++ b/tsv/daily/index.xml @@ -1,7 +1,7 @@ GitHub TSV Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:08Z + 2024-12-10T01:38:06Z Daily Trending of TSV in GitHub \ No newline at end of file diff --git a/tsx/daily/index.xml b/tsx/daily/index.xml index 4b23e9e9b64..1727cc72162 100644 --- a/tsx/daily/index.xml +++ b/tsx/daily/index.xml @@ -1,7 +1,7 @@ GitHub TSX Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:09Z + 2024-12-10T01:38:06Z Daily Trending of TSX in GitHub \ No newline at end of file diff --git a/turing/daily/index.xml b/turing/daily/index.xml index d978d989ade..4eb38250d0a 100644 --- a/turing/daily/index.xml +++ b/turing/daily/index.xml @@ -1,7 +1,7 @@ GitHub Turing Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:07Z + 2024-12-10T01:38:07Z Daily Trending of Turing in GitHub \ No newline at end of file diff --git a/turtle/daily/index.xml b/turtle/daily/index.xml index 0b6d748c74a..e34dcaf4b70 100644 --- a/turtle/daily/index.xml +++ b/turtle/daily/index.xml @@ -1,7 +1,7 @@ GitHub Turtle Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:10Z + 2024-12-10T01:38:08Z Daily Trending of Turtle in GitHub \ No newline at end of file diff --git a/twig/daily/index.xml b/twig/daily/index.xml index 4f18a503b2b..7f99f2c1afc 100644 --- a/twig/daily/index.xml +++ b/twig/daily/index.xml @@ -1,7 +1,7 @@ GitHub Twig Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:10Z + 2024-12-10T01:38:09Z Daily Trending of Twig in GitHub \ No newline at end of file diff --git a/txl/daily/index.xml b/txl/daily/index.xml index b7049b5afb0..48b4e0133eb 100644 --- a/txl/daily/index.xml +++ b/txl/daily/index.xml @@ -1,7 +1,7 @@ GitHub TXL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:09Z + 2024-12-10T01:38:08Z Daily Trending of TXL in GitHub \ No newline at end of file diff --git a/type-language/daily/index.xml b/type-language/daily/index.xml index aa40eead75a..fe3318e9778 100644 --- a/type-language/daily/index.xml +++ b/type-language/daily/index.xml @@ -1,7 +1,7 @@ GitHub Type Language Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:10Z + 2024-12-10T01:38:08Z Daily Trending of Type Language in GitHub \ No newline at end of file diff --git a/typescript/daily/index.xml b/typescript/daily/index.xml index 656d7d5fb50..dcc2c6483ac 100644 --- a/typescript/daily/index.xml +++ b/typescript/daily/index.xml @@ -1,21 +1,7 @@ GitHub TypeScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:19Z + 2024-12-10T01:38:11Z Daily Trending of TypeScript in GitHub - - 530051970/zenith-cloudkit - 2024-12-09T01:36:19Z - tag:github.com,2024-12-09:/530051970/zenith-cloudkit - - <p>Some tools for cloud developers</p><hr><h1>Zenith Cloudkit</h1> <p>English | <a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/README_zh.md">简体中文</a></p> <p>Welcome to Zenith Cloudkit! This is a fantastic toolkit designed to make your cloud development more easier. Whether you're a seasoned professional or just getting started, this README will guide you through everything you need to know to get up and running with Zenith Cloudkit.</p> <h2>Table of Contents</h2> <ul> <li><a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/#getting-started">Getting Started</a> <ul> <li><a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/#architecture">Architecture</a></li> <li><a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/#installation">Installation</a></li> <li><a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/#usage">Usage</a></li> </ul> </li> <li><a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/#features">Features</a></li> <li><a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/#contributing">Contributing</a></li> <li><a href="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/#license">License</a></li> </ul> <h2>Getting Started</h2> <p>These instructions will help you install and use Zenith Cloudkit on your local machine.</p> <h3>Architecture</h3> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/architecture.png" alt="architecture"></p> <h3>Installation</h3> <p>To install Zenith Cloudkit, simply follow these steps:</p> <ol> <li> <p>Clone this repository to your local machine:</p> <pre><code class="language-bash">git clone https://github.com/530051970/zenith-cloudkit.git </code></pre> </li> <li> <p>Navigate to the directory containing Zenith Cloudkit:</p> <pre><code class="language-bash">cd zenith-cloudkit/source/app </code></pre> </li> <li> <p>Install the necessary dependencies:</p> <pre><code class="language-bash">npm install </code></pre> </li> </ol> <h3>Usage</h3> <ol> <li> <p>Once installed, you can use Zenith Cloudkit by running the following command:</p> <pre><code class="language-bash">npm run start </code></pre> </li> </ol> <p>This will start the application and you can access it at <a href="http://localhost:3000">http://localhost:3000</a> in your web browser.</p> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/login.png" alt="login"></p> <h3>Features</h3> <ul> <li>Feature 1: Tools. <h3>S3 Crusher</h3> When deleting an S3 bucket via the console, it must be manually emptied first, as shown in the picture below.</li> </ul> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/emptyS3.png" alt="emptyS3"></p> <p>In a real-world scenarios, there are often dozens of S3 buckets that need to be cleaned up, and manually deleting them one by one is very inefficient. S3 Crusher can be used to delete multiple S3 buckets in one click, regardless of whether the buckets are empty, as shown in the picture below.</p> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/s3crusher-1.png" alt="s3crusher-1"> <img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/s3crusher-2.png" alt="s3crusher-2"></p> <h3>NAT Traversal</h3> <p>In cloud application development, it is common to encounter scenarios where you need to connect to VPC private subnet resources from a local environment. Typically, this requires setting up a bastion host within the VPC and configuring security groups, which is a cumbersome process. With this tool, you can easily set up a bastion host in two steps, enabling access to cloud resources from the local environment.</p> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/nat-1.png" alt="nat-1"> <img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/nat-2.png" alt="nat-2"></p> <ul> <li>Feature 2: Templates. This module will gradually release a series of small applications. Users can download the corresponding templates, deploy them to their accounts, and start using them immediately. If needed, you can submit an issue to contact the author for new templates development. You are also welcome to click here to submit a PR for secondary development.</li> </ul> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/template.png" alt="template"></p> <h3>Data-Generator</h3> <p>During the development of B2B products, B2C products, or model training, the requirements for datasets are becoming increasingly stringent. Generally, these can be summarized as follows: <img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/dataset.png" alt="dataset"> This product allows you to complete the entire process from data generation to data injection in just a few simple steps. The specifics are as follows: 1）Customize fields</p> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/customize-fields.png" alt="customize"></p> <p>2）Config tool params</p> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/tool-params.png" alt="params"></p> <p>3）Set output endpoint</p> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/endpoint.png" alt="endpoint"></p> <p>4）Preview &amp; Start</p> <p><img src="https://raw.githubusercontent.com/530051970/zenith-cloudkit/main/source/app/public/imgs/preview.png" alt="preview"></p> <ul> <li>Feature 3: Scaffold. Continuous updates are on the way, so stay tuned.</li> </ul> <h3>Contributing</h3> <p>We welcome contributions from the community! If you have ideas for new features or improvements, please open an issue or submit a pull request.</p> <ol> <li> <p>Fork the repository.</p> </li> <li> <p>Create your feature branch:</p> <pre><code class="language-bash">git checkout -b my-new-feature </code></pre> </li> <li> <p>Commit your changes:</p> <pre><code class="language-bash">git commit -am 'Add some feature' </code></pre> </li> <li> <p>Push to the branch:</p> <pre><code class="language-bash">git push origin my-new-feature </code></pre> </li> <li> <p>Submit a pull request.</p> </li> </ol> <h3>License</h3> <p>This project is licensed under the Apache License Version 2.0 - see the <a href="http://www.apache.org/licenses/">LICENSE</a> file for details.</p> - - - anthropics/anthropic-quickstarts - 2024-12-09T01:36:19Z - tag:github.com,2024-12-09:/anthropics/anthropic-quickstarts - - <p>A collection of projects designed to help developers quickly get started with building deployable applications using the Anthropic API</p><hr><h1>Anthropic Quickstarts</h1> <p>Anthropic Quickstarts is a collection of projects designed to help developers quickly get started with building applications using the Anthropic API. Each quickstart provides a foundation that you can easily build upon and customize for your specific needs.</p> <h2>Getting Started</h2> <p>To use these quickstarts, you'll need an Anthropic API key. If you don't have one yet, you can sign up for free at <a href="https://console.anthropic.com">console.anthropic.com</a>.</p> <h2>Available Quickstarts</h2> <h3>Customer Support Agent</h3> <p>A customer support agent powered by Claude. This project demonstrates how to leverage Claude's natural language understanding and generation capabilities to create an AI-assisted customer support system with access to a knowledge base.</p> <p><a href="https://raw.githubusercontent.com/anthropics/anthropic-quickstarts/main/customer-support-agent">Go to Customer Support Agent Quickstart</a></p> <h3>Financial Data Analyst</h3> <p>A financial data analyst powered by Claude. This project demonstrates how to leverage Claude's capabilities with interactive data visualization to analyze financial data via chat.</p> <p><a href="https://raw.githubusercontent.com/anthropics/anthropic-quickstarts/main/financial-data-analyst">Go to Financial Data Analyst Quickstart</a></p> <h3>Computer Use Demo</h3> <p>An environment and tools that Claude can use to control a desktop computer. This project demonstrates how to leverage the computer use capabilities of the new Claude 3.5 Sonnet model.</p> <p><a href="https://raw.githubusercontent.com/anthropics/anthropic-quickstarts/main/computer-use-demo">Go to Computer Use Demo Quickstart</a></p> <h2>General Usage</h2> <p>Each quickstart project comes with its own README and setup instructions. Generally, you'll follow these steps:</p> <ol> <li>Clone this repository</li> <li>Navigate to the specific quickstart directory</li> <li>Install the required dependencies</li> <li>Set up your Anthropic API key as an environment variable</li> <li>Run the quickstart application</li> </ol> <h2>Explore Further</h2> <p>To deepen your understanding of working with Claude and the Anthropic API, check out these resources:</p> <ul> <li><a href="https://docs.anthropic.com">Anthropic API Documentation</a></li> <li><a href="https://github.com/anthropics/anthropic-cookbook">Anthropic Cookbook</a> - A collection of code snippets and guides for common tasks</li> <li><a href="https://github.com/anthropics/courses/tree/master/anthropic_api_fundamentals">Anthropic API Fundamentals Course</a></li> </ul> <h2>Contributing</h2> <p>We welcome contributions to the Anthropic Quickstarts repository! If you have ideas for new quickstart projects or improvements to existing ones, please open an issue or submit a pull request.</p> <h2>Community and Support</h2> <ul> <li>Join our <a href="https://www.anthropic.com/discord">Anthropic Discord community</a> for discussions and support</li> <li>Check out the <a href="https://support.anthropic.com">Anthropic support documentation</a> for additional help</li> </ul> <h2>License</h2> <p>This project is licensed under the MIT License - see the <a href="https://raw.githubusercontent.com/anthropics/anthropic-quickstarts/main/LICENSE">LICENSE</a> file for details.</p> - \ No newline at end of file diff --git a/unified-parallel-c/daily/index.xml b/unified-parallel-c/daily/index.xml index f96cb31709c..25ad4497307 100644 --- a/unified-parallel-c/daily/index.xml +++ b/unified-parallel-c/daily/index.xml @@ -1,7 +1,7 @@ GitHub Unified Parallel C Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:11Z + 2024-12-10T01:38:09Z Daily Trending of Unified Parallel C in GitHub \ No newline at end of file diff --git a/unity3d-asset/daily/index.xml b/unity3d-asset/daily/index.xml index 7ef305c2c9e..4ff364403df 100644 --- a/unity3d-asset/daily/index.xml +++ b/unity3d-asset/daily/index.xml @@ -1,7 +1,7 @@ GitHub Unity3D Asset Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:23Z + 2024-12-10T01:38:15Z Daily Trending of Unity3D Asset in GitHub \ No newline at end of file diff --git a/unix-assembly/daily/index.xml b/unix-assembly/daily/index.xml index d063134ff69..a17e2015255 100644 --- a/unix-assembly/daily/index.xml +++ b/unix-assembly/daily/index.xml @@ -1,7 +1,7 @@ GitHub Unix Assembly Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:22Z + 2024-12-10T01:38:14Z Daily Trending of Unix Assembly in GitHub \ No newline at end of file diff --git a/unknown/daily/index.xml b/unknown/daily/index.xml index 0a4dd6d1883..815823d6e0d 100644 --- a/unknown/daily/index.xml +++ b/unknown/daily/index.xml @@ -1,7 +1,7 @@ GitHub Unknown languages Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:28:56Z + 2024-12-10T01:28:45Z Daily Trending of Unknown languages in GitHub \ No newline at end of file diff --git a/uno/daily/index.xml b/uno/daily/index.xml index 273c7621ed3..f54b8812554 100644 --- a/uno/daily/index.xml +++ b/uno/daily/index.xml @@ -1,7 +1,7 @@ GitHub Uno Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:22Z + 2024-12-10T01:38:15Z Daily Trending of Uno in GitHub \ No newline at end of file diff --git a/unrealscript/daily/index.xml b/unrealscript/daily/index.xml index 8ad5c196475..ec81357e730 100644 --- a/unrealscript/daily/index.xml +++ b/unrealscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub UnrealScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:23Z + 2024-12-10T01:38:15Z Daily Trending of UnrealScript in GitHub \ No newline at end of file diff --git a/urweb/daily/index.xml b/urweb/daily/index.xml index f44c3a98f08..e868d1596dd 100644 --- a/urweb/daily/index.xml +++ b/urweb/daily/index.xml @@ -1,7 +1,7 @@ GitHub UrWeb Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:24Z + 2024-12-10T01:38:16Z Daily Trending of UrWeb in GitHub \ No newline at end of file diff --git a/v/daily/index.xml b/v/daily/index.xml index 73d27b474f8..e8d3e693ae6 100644 --- a/v/daily/index.xml +++ b/v/daily/index.xml @@ -1,7 +1,7 @@ GitHub V Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:24Z + 2024-12-10T01:38:16Z Daily Trending of V in GitHub \ No newline at end of file diff --git a/vala/daily/index.xml b/vala/daily/index.xml index de179771a6d..801761094b3 100644 --- a/vala/daily/index.xml +++ b/vala/daily/index.xml @@ -1,7 +1,7 @@ GitHub Vala Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:25Z + 2024-12-10T01:38:17Z Daily Trending of Vala in GitHub \ No newline at end of file diff --git a/valve-data-format/daily/index.xml b/valve-data-format/daily/index.xml index 9a7fdc91e07..74018b02f85 100644 --- a/valve-data-format/daily/index.xml +++ b/valve-data-format/daily/index.xml @@ -1,7 +1,7 @@ GitHub Valve Data Format Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:24Z + 2024-12-10T01:38:16Z Daily Trending of Valve Data Format in GitHub \ No newline at end of file diff --git a/vba/daily/index.xml b/vba/daily/index.xml index 3d21c280502..2cc4becff01 100644 --- a/vba/daily/index.xml +++ b/vba/daily/index.xml @@ -1,7 +1,7 @@ GitHub VBA Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:26Z + 2024-12-10T01:38:19Z Daily Trending of VBA in GitHub \ No newline at end of file diff --git a/vbscript/daily/index.xml b/vbscript/daily/index.xml index f69810a7366..b665112fabd 100644 --- a/vbscript/daily/index.xml +++ b/vbscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub VBScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:27Z + 2024-12-10T01:38:18Z Daily Trending of VBScript in GitHub \ No newline at end of file diff --git a/vcl/daily/index.xml b/vcl/daily/index.xml index a15f92983b8..1d7cb679458 100644 --- a/vcl/daily/index.xml +++ b/vcl/daily/index.xml @@ -1,7 +1,7 @@ GitHub VCL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:26Z + 2024-12-10T01:38:18Z Daily Trending of VCL in GitHub \ No newline at end of file diff --git a/verilog/daily/index.xml b/verilog/daily/index.xml index 24369d78415..b8a314d1d8b 100644 --- a/verilog/daily/index.xml +++ b/verilog/daily/index.xml @@ -1,7 +1,7 @@ GitHub Verilog Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:28Z + 2024-12-10T01:38:20Z Daily Trending of Verilog in GitHub \ No newline at end of file diff --git a/vhdl/daily/index.xml b/vhdl/daily/index.xml index 239f5db499e..f603d49e71d 100644 --- a/vhdl/daily/index.xml +++ b/vhdl/daily/index.xml @@ -1,7 +1,7 @@ GitHub VHDL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:29Z + 2024-12-10T01:38:20Z Daily Trending of VHDL in GitHub \ No newline at end of file diff --git a/vim-help-file/daily/index.xml b/vim-help-file/daily/index.xml index 9d0cf60b162..c064e780af2 100644 --- a/vim-help-file/daily/index.xml +++ b/vim-help-file/daily/index.xml @@ -1,7 +1,7 @@ GitHub Vim Help File Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:27Z + 2024-12-10T01:38:20Z Daily Trending of Vim Help File in GitHub \ No newline at end of file diff --git a/vim-script/daily/index.xml b/vim-script/daily/index.xml index 715c0a91672..3974e05f4d8 100644 --- a/vim-script/daily/index.xml +++ b/vim-script/daily/index.xml @@ -1,7 +1,7 @@ GitHub Vim Script Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:31Z + 2024-12-10T01:38:23Z Daily Trending of Vim Script in GitHub \ No newline at end of file diff --git a/vim-snippet/daily/index.xml b/vim-snippet/daily/index.xml index fa27a5b70f8..cac85302d98 100644 --- a/vim-snippet/daily/index.xml +++ b/vim-snippet/daily/index.xml @@ -1,7 +1,7 @@ GitHub Vim Snippet Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:29Z + 2024-12-10T01:38:22Z Daily Trending of Vim Snippet in GitHub \ No newline at end of file diff --git a/visual-basic-.net/daily/index.xml b/visual-basic-.net/daily/index.xml index aa5746e73d2..734f847798e 100644 --- a/visual-basic-.net/daily/index.xml +++ b/visual-basic-.net/daily/index.xml @@ -1,7 +1,7 @@ GitHub Visual Basic .NET Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:30Z + 2024-12-10T01:38:21Z Daily Trending of Visual Basic .NET in GitHub \ No newline at end of file diff --git a/volt/daily/index.xml b/volt/daily/index.xml index 8e1702c2567..8172a33460f 100644 --- a/volt/daily/index.xml +++ b/volt/daily/index.xml @@ -1,7 +1,7 @@ GitHub Volt Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:33Z + 2024-12-10T01:38:24Z Daily Trending of Volt in GitHub \ No newline at end of file diff --git a/vue/daily/index.xml b/vue/daily/index.xml index bc23fa42772..52a8aa5beca 100644 --- a/vue/daily/index.xml +++ b/vue/daily/index.xml @@ -1,7 +1,14 @@ GitHub Vue Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:33Z + 2024-12-10T01:38:25Z Daily Trending of Vue in GitHub + + dairoot/ChatGPT-Mirror + 2024-12-10T01:38:25Z + tag:github.com,2024-12-10:/dairoot/ChatGPT-Mirror + + <p>🚀 一键部署个人的 ChatGPT 镜像站</p><hr> + \ No newline at end of file diff --git a/vyper/daily/index.xml b/vyper/daily/index.xml index 80e8feeaeb6..d80d69f995f 100644 --- a/vyper/daily/index.xml +++ b/vyper/daily/index.xml @@ -1,7 +1,7 @@ GitHub Vyper Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:32Z + 2024-12-10T01:38:24Z Daily Trending of Vyper in GitHub \ No newline at end of file diff --git a/wavefront-material/daily/index.xml b/wavefront-material/daily/index.xml index 3b4009f4e1d..5be97d9d63a 100644 --- a/wavefront-material/daily/index.xml +++ b/wavefront-material/daily/index.xml @@ -1,7 +1,7 @@ GitHub Wavefront Material Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:32Z + 2024-12-10T01:38:24Z Daily Trending of Wavefront Material in GitHub \ No newline at end of file diff --git a/wavefront-object/daily/index.xml b/wavefront-object/daily/index.xml index 661d4a3d646..0124b66d46d 100644 --- a/wavefront-object/daily/index.xml +++ b/wavefront-object/daily/index.xml @@ -1,7 +1,7 @@ GitHub Wavefront Object Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:34Z + 2024-12-10T01:38:26Z Daily Trending of Wavefront Object in GitHub \ No newline at end of file diff --git a/wdl/daily/index.xml b/wdl/daily/index.xml index 3b177a44f0a..70fd6f91c25 100644 --- a/wdl/daily/index.xml +++ b/wdl/daily/index.xml @@ -1,7 +1,7 @@ GitHub WDL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:35Z + 2024-12-10T01:38:26Z Daily Trending of WDL in GitHub \ No newline at end of file diff --git a/web-ontology-language/daily/index.xml b/web-ontology-language/daily/index.xml index 299ee0dd1a9..9fca6763465 100644 --- a/web-ontology-language/daily/index.xml +++ b/web-ontology-language/daily/index.xml @@ -1,7 +1,7 @@ GitHub Web Ontology Language Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:34Z + 2024-12-10T01:38:26Z Daily Trending of Web Ontology Language in GitHub \ No newline at end of file diff --git a/webassembly/daily/index.xml b/webassembly/daily/index.xml index 25879cd6af5..a33bacbde8e 100644 --- a/webassembly/daily/index.xml +++ b/webassembly/daily/index.xml @@ -1,7 +1,7 @@ GitHub WebAssembly Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:35Z + 2024-12-10T01:38:27Z Daily Trending of WebAssembly in GitHub \ No newline at end of file diff --git a/webidl/daily/index.xml b/webidl/daily/index.xml index 7c4d1b1d9d9..3d71e515ef3 100644 --- a/webidl/daily/index.xml +++ b/webidl/daily/index.xml @@ -1,7 +1,7 @@ GitHub WebIDL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:36Z + 2024-12-10T01:38:28Z Daily Trending of WebIDL in GitHub \ No newline at end of file diff --git a/webvtt/daily/index.xml b/webvtt/daily/index.xml index 5e9b7a49421..1167d40ac05 100644 --- a/webvtt/daily/index.xml +++ b/webvtt/daily/index.xml @@ -1,7 +1,7 @@ GitHub WebVTT Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:37Z + 2024-12-10T01:38:28Z Daily Trending of WebVTT in GitHub \ No newline at end of file diff --git a/wget-config/daily/index.xml b/wget-config/daily/index.xml index f41d9fe6bd1..5ce147e8e8c 100644 --- a/wget-config/daily/index.xml +++ b/wget-config/daily/index.xml @@ -1,7 +1,7 @@ GitHub Wget Config Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:36Z + 2024-12-10T01:38:27Z Daily Trending of Wget Config in GitHub \ No newline at end of file diff --git a/wikitext/daily/index.xml b/wikitext/daily/index.xml index 5a0b47e97de..2c719f9a70a 100644 --- a/wikitext/daily/index.xml +++ b/wikitext/daily/index.xml @@ -1,7 +1,7 @@ GitHub Wikitext Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:33:15Z + 2024-12-10T01:35:09Z Daily Trending of Wikitext in GitHub \ No newline at end of file diff --git a/windows-registry-entries/daily/index.xml b/windows-registry-entries/daily/index.xml index df7c8afb6cf..7c543ce75ac 100644 --- a/windows-registry-entries/daily/index.xml +++ b/windows-registry-entries/daily/index.xml @@ -1,7 +1,7 @@ GitHub Windows Registry Entries Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:38Z + 2024-12-10T01:38:29Z Daily Trending of Windows Registry Entries in GitHub \ No newline at end of file diff --git a/wisp/daily/index.xml b/wisp/daily/index.xml index 0507d63f2ef..34eab8f2780 100644 --- a/wisp/daily/index.xml +++ b/wisp/daily/index.xml @@ -1,7 +1,7 @@ GitHub wisp Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:39Z + 2024-12-10T01:38:31Z Daily Trending of wisp in GitHub \ No newline at end of file diff --git a/witcher-script/daily/index.xml b/witcher-script/daily/index.xml index c7e868d904e..48b9cccc560 100644 --- a/witcher-script/daily/index.xml +++ b/witcher-script/daily/index.xml @@ -1,7 +1,7 @@ GitHub Witcher Script Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:39Z + 2024-12-10T01:38:31Z Daily Trending of Witcher Script in GitHub \ No newline at end of file diff --git a/wollok/daily/index.xml b/wollok/daily/index.xml index 36614341455..9766d85e117 100644 --- a/wollok/daily/index.xml +++ b/wollok/daily/index.xml @@ -1,7 +1,7 @@ GitHub Wollok Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:40Z + 2024-12-10T01:38:31Z Daily Trending of Wollok in GitHub \ No newline at end of file diff --git a/world-of-warcraft-addon-data/daily/index.xml b/world-of-warcraft-addon-data/daily/index.xml index debd26d5122..1137938b476 100644 --- a/world-of-warcraft-addon-data/daily/index.xml +++ b/world-of-warcraft-addon-data/daily/index.xml @@ -1,7 +1,7 @@ GitHub World of Warcraft Addon Data Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:40Z + 2024-12-10T01:38:30Z Daily Trending of World of Warcraft Addon Data in GitHub \ No newline at end of file diff --git a/x-bitmap/daily/index.xml b/x-bitmap/daily/index.xml index 4af3355232e..c55afe8dc7c 100644 --- a/x-bitmap/daily/index.xml +++ b/x-bitmap/daily/index.xml @@ -1,7 +1,7 @@ GitHub X BitMap Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:42Z + 2024-12-10T01:38:32Z Daily Trending of X BitMap in GitHub \ No newline at end of file diff --git a/x-font-directory-index/daily/index.xml b/x-font-directory-index/daily/index.xml index 24f5f5eab37..29e56c8892f 100644 --- a/x-font-directory-index/daily/index.xml +++ b/x-font-directory-index/daily/index.xml @@ -1,7 +1,7 @@ GitHub X Font Directory Index Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:41Z + 2024-12-10T01:38:32Z Daily Trending of X Font Directory Index in GitHub \ No newline at end of file diff --git a/x-pixmap/daily/index.xml b/x-pixmap/daily/index.xml index c2be02af69e..b943126f4af 100644 --- a/x-pixmap/daily/index.xml +++ b/x-pixmap/daily/index.xml @@ -1,7 +1,7 @@ GitHub X PixMap Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:41Z + 2024-12-10T01:38:32Z Daily Trending of X PixMap in GitHub \ No newline at end of file diff --git a/x10/daily/index.xml b/x10/daily/index.xml index 173c9b24f13..f82c19469a3 100644 --- a/x10/daily/index.xml +++ b/x10/daily/index.xml @@ -1,7 +1,7 @@ GitHub X10 Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:42Z + 2024-12-10T01:38:33Z Daily Trending of X10 in GitHub \ No newline at end of file diff --git a/xbase/daily/index.xml b/xbase/daily/index.xml index 3ea0d4defde..52528ead23d 100644 --- a/xbase/daily/index.xml +++ b/xbase/daily/index.xml @@ -1,7 +1,7 @@ GitHub xBase Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:43Z + 2024-12-10T01:38:34Z Daily Trending of xBase in GitHub \ No newline at end of file diff --git a/xc/daily/index.xml b/xc/daily/index.xml index 9e173e3ca30..aa68dddd27b 100644 --- a/xc/daily/index.xml +++ b/xc/daily/index.xml @@ -1,7 +1,7 @@ GitHub XC Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:43Z + 2024-12-10T01:38:34Z Daily Trending of XC in GitHub \ No newline at end of file diff --git a/xcompose/daily/index.xml b/xcompose/daily/index.xml index 7113522c87b..9e6218ef00d 100644 --- a/xcompose/daily/index.xml +++ b/xcompose/daily/index.xml @@ -1,7 +1,7 @@ GitHub XCompose Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:43Z + 2024-12-10T01:38:34Z Daily Trending of XCompose in GitHub \ No newline at end of file diff --git a/xml-property-list/daily/index.xml b/xml-property-list/daily/index.xml index f32925c0995..d0d66a8f7e8 100644 --- a/xml-property-list/daily/index.xml +++ b/xml-property-list/daily/index.xml @@ -1,7 +1,7 @@ GitHub XML Property List Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:44Z + 2024-12-10T01:38:35Z Daily Trending of XML Property List in GitHub \ No newline at end of file diff --git a/xml/daily/index.xml b/xml/daily/index.xml index 3cd9a4b4735..15d44184565 100644 --- a/xml/daily/index.xml +++ b/xml/daily/index.xml @@ -1,7 +1,7 @@ GitHub XML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:45Z + 2024-12-10T01:38:36Z Daily Trending of XML in GitHub \ No newline at end of file diff --git a/xojo/daily/index.xml b/xojo/daily/index.xml index 50f250af1fd..4a118351fda 100644 --- a/xojo/daily/index.xml +++ b/xojo/daily/index.xml @@ -1,7 +1,7 @@ GitHub Xojo Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:44Z + 2024-12-10T01:38:35Z Daily Trending of Xojo in GitHub \ No newline at end of file diff --git a/xonsh/daily/index.xml b/xonsh/daily/index.xml index 8c888835cf4..af6db50eb22 100644 --- a/xonsh/daily/index.xml +++ b/xonsh/daily/index.xml @@ -1,7 +1,7 @@ GitHub Xonsh Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:44Z + 2024-12-10T01:38:35Z Daily Trending of Xonsh in GitHub \ No newline at end of file diff --git a/xpages/daily/index.xml b/xpages/daily/index.xml index 469528f37d3..80d1794a152 100644 --- a/xpages/daily/index.xml +++ b/xpages/daily/index.xml @@ -1,7 +1,7 @@ GitHub XPages Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:46Z + 2024-12-10T01:38:37Z Daily Trending of XPages in GitHub \ No newline at end of file diff --git a/xproc/daily/index.xml b/xproc/daily/index.xml index 3a9848b425a..f1b3ca52daf 100644 --- a/xproc/daily/index.xml +++ b/xproc/daily/index.xml @@ -1,7 +1,7 @@ GitHub XProc Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:46Z + 2024-12-10T01:38:38Z Daily Trending of XProc in GitHub \ No newline at end of file diff --git a/xquery/daily/index.xml b/xquery/daily/index.xml index ff436017ea6..24983ea9f87 100644 --- a/xquery/daily/index.xml +++ b/xquery/daily/index.xml @@ -1,7 +1,7 @@ GitHub XQuery Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:47Z + 2024-12-10T01:38:38Z Daily Trending of XQuery in GitHub \ No newline at end of file diff --git a/xs/daily/index.xml b/xs/daily/index.xml index 530eacdcd98..2d344fbfba2 100644 --- a/xs/daily/index.xml +++ b/xs/daily/index.xml @@ -1,7 +1,7 @@ GitHub XS Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:47Z + 2024-12-10T01:38:37Z Daily Trending of XS in GitHub \ No newline at end of file diff --git a/xslt/daily/index.xml b/xslt/daily/index.xml index 8d8c33cc6fa..ceec8719c7d 100644 --- a/xslt/daily/index.xml +++ b/xslt/daily/index.xml @@ -1,7 +1,7 @@ GitHub XSLT Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:49Z + 2024-12-10T01:38:40Z Daily Trending of XSLT in GitHub \ No newline at end of file diff --git a/xtend/daily/index.xml b/xtend/daily/index.xml index 887570953d8..8b59f70b7b6 100644 --- a/xtend/daily/index.xml +++ b/xtend/daily/index.xml @@ -1,7 +1,7 @@ GitHub Xtend Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:48Z + 2024-12-10T01:38:39Z Daily Trending of Xtend in GitHub \ No newline at end of file diff --git a/yacc/daily/index.xml b/yacc/daily/index.xml index 9bf33716dd5..096c3770899 100644 --- a/yacc/daily/index.xml +++ b/yacc/daily/index.xml @@ -1,7 +1,7 @@ GitHub Yacc Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:48Z + 2024-12-10T01:38:39Z Daily Trending of Yacc in GitHub \ No newline at end of file diff --git a/yaml/daily/index.xml b/yaml/daily/index.xml index 6c28b04b1d3..35b151cffb5 100644 --- a/yaml/daily/index.xml +++ b/yaml/daily/index.xml @@ -1,7 +1,7 @@ GitHub YAML Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:48Z + 2024-12-10T01:38:39Z Daily Trending of YAML in GitHub \ No newline at end of file diff --git a/yang/daily/index.xml b/yang/daily/index.xml index 9b594d4824e..09c182d78ca 100644 --- a/yang/daily/index.xml +++ b/yang/daily/index.xml @@ -1,7 +1,7 @@ GitHub YANG Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:50Z + 2024-12-10T01:38:42Z Daily Trending of YANG in GitHub \ No newline at end of file diff --git a/yara/daily/index.xml b/yara/daily/index.xml index 23a556bf6ac..cbbff813e85 100644 --- a/yara/daily/index.xml +++ b/yara/daily/index.xml @@ -1,7 +1,7 @@ GitHub YARA Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:51Z + 2024-12-10T01:38:42Z Daily Trending of YARA in GitHub \ No newline at end of file diff --git a/yasnippet/daily/index.xml b/yasnippet/daily/index.xml index 3228fd07404..b515c85e4aa 100644 --- a/yasnippet/daily/index.xml +++ b/yasnippet/daily/index.xml @@ -1,7 +1,7 @@ GitHub YASnippet Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:51Z + 2024-12-10T01:38:41Z Daily Trending of YASnippet in GitHub \ No newline at end of file diff --git a/zap/daily/index.xml b/zap/daily/index.xml index 75769d18486..946ce977491 100644 --- a/zap/daily/index.xml +++ b/zap/daily/index.xml @@ -1,7 +1,7 @@ GitHub ZAP Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:52Z + 2024-12-10T01:38:43Z Daily Trending of ZAP in GitHub \ No newline at end of file diff --git a/zeek/daily/index.xml b/zeek/daily/index.xml index 6a58b59955b..887ae975d84 100644 --- a/zeek/daily/index.xml +++ b/zeek/daily/index.xml @@ -1,7 +1,7 @@ GitHub Zeek Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:29:27Z + 2024-12-10T01:29:16Z Daily Trending of Zeek in GitHub \ No newline at end of file diff --git a/zenscript/daily/index.xml b/zenscript/daily/index.xml index 070552406ad..ac2ce9e2390 100644 --- a/zenscript/daily/index.xml +++ b/zenscript/daily/index.xml @@ -1,7 +1,7 @@ GitHub ZenScript Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:53Z + 2024-12-10T01:38:43Z Daily Trending of ZenScript in GitHub \ No newline at end of file diff --git a/zephir/daily/index.xml b/zephir/daily/index.xml index bbc037093f7..c5dd3b50998 100644 --- a/zephir/daily/index.xml +++ b/zephir/daily/index.xml @@ -1,7 +1,7 @@ GitHub Zephir Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:52Z + 2024-12-10T01:38:43Z Daily Trending of Zephir in GitHub \ No newline at end of file diff --git a/zig/daily/index.xml b/zig/daily/index.xml index 9061274a36d..bac8ff174da 100644 --- a/zig/daily/index.xml +++ b/zig/daily/index.xml @@ -1,7 +1,7 @@ GitHub Zig Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:54Z + 2024-12-10T01:38:44Z Daily Trending of Zig in GitHub \ No newline at end of file diff --git a/zil/daily/index.xml b/zil/daily/index.xml index 88c870c6c0e..51b8b4bcef9 100644 --- a/zil/daily/index.xml +++ b/zil/daily/index.xml @@ -1,7 +1,7 @@ GitHub ZIL Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:54Z + 2024-12-10T01:38:45Z Daily Trending of ZIL in GitHub \ No newline at end of file diff --git a/zimpl/daily/index.xml b/zimpl/daily/index.xml index 3d5134bfca7..59b3f5865eb 100644 --- a/zimpl/daily/index.xml +++ b/zimpl/daily/index.xml @@ -1,7 +1,7 @@ GitHub Zimpl Daily Trending http://mshibanami.github.io/GitHubTrendingRSS - 2024-12-09T01:36:55Z + 2024-12-10T01:38:45Z Daily Trending of Zimpl in GitHub \ No newline at end of file