Skip to content
New issue

Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.

By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.

Already on GitHub? Sign in to your account

Update record length when translating FASTA inputs #15

Open
khughitt opened this issue Mar 3, 2015 · 0 comments
Open

Update record length when translating FASTA inputs #15

khughitt opened this issue Mar 3, 2015 · 0 comments

Comments

@khughitt
Copy link
Owner

khughitt commented Mar 3, 2015

When translating test/input/dna.fasta, the outputted length reflects the original DNA sequence length and not the translated length:

>LmjF.23.1060  | Leishmania major strain Friedlin | hydrophilic acylated surface protein b (HASPB1) | genomic | LmjF.23 reverse | (geneStart+0 to geneEnd+0) | length=534
MGSSCTKDSAKEPQKSADKIKSTNETNQGGNASGSRKSAGGRTNEYDPKDDGFTPNNEDRCPKEDGHTGK
NDDGGPKEDGHAPKNDDHAPKEDGHAPKNDDHAPKEDGHAPKNDDHAPKEDGHAPKNDDHAPKEDGHAPK
NDGDVQKKSEDGDNVGEGGKGNEDGNDDQPKEHAAGN*

Instead, perhaps the length should be updated to reflect the protein sequence (here, 178 if the stop codon is included).

Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment
Projects
None yet
Development

No branches or pull requests

1 participant