diff --git a/go.mod b/go.mod index 2168a48899..cd467f692c 100644 --- a/go.mod +++ b/go.mod @@ -21,6 +21,7 @@ require ( github.com/containers/storage v1.52.1-0.20240202181245-1419a5980565 github.com/coreos/go-systemd/v22 v22.5.1-0.20231103132048-7d375ecc2b09 github.com/coreos/stream-metadata-go v0.4.4 + github.com/crc-org/crc/v2 v2.32.0 github.com/crc-org/vfkit v0.5.0 github.com/cyphar/filepath-securejoin v0.2.4 github.com/digitalocean/go-qemu v0.0.0-20230711162256-2e3d0186973e @@ -104,7 +105,7 @@ require ( github.com/coreos/go-oidc/v3 v3.9.0 // indirect github.com/coreos/go-systemd v0.0.0-20190719114852-fd7a80b32e1f // indirect github.com/cyberphone/json-canonicalization v0.0.0-20231217050601-ba74d44ecf5f // indirect - github.com/davecgh/go-spew v1.1.1 // indirect + github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc // indirect github.com/digitalocean/go-libvirt v0.0.0-20220804181439-8648fbde413e // indirect github.com/disiqueira/gotree/v3 v3.0.2 // indirect github.com/distribution/reference v0.5.0 // indirect @@ -148,7 +149,7 @@ require ( github.com/jinzhu/copier v0.4.0 // indirect github.com/josharian/intern v1.0.0 // indirect github.com/klauspost/compress v1.17.5 // indirect - github.com/klauspost/cpuid/v2 v2.2.5 // indirect + github.com/klauspost/cpuid/v2 v2.2.6 // indirect github.com/klauspost/pgzip v1.2.6 // indirect github.com/kr/fs v0.1.0 // indirect github.com/kr/pretty v0.3.1 // indirect @@ -157,6 +158,7 @@ require ( github.com/lufia/plan9stats v0.0.0-20211012122336-39d0f177ccd0 // indirect github.com/mailru/easyjson v0.7.7 // indirect github.com/manifoldco/promptui v0.9.0 // indirect + github.com/mattn/go-colorable v0.1.13 // indirect github.com/mattn/go-isatty v0.0.19 // indirect github.com/mattn/go-runewidth v0.0.15 // indirect github.com/mdlayher/socket v0.4.1 // indirect @@ -176,7 +178,7 @@ require ( github.com/pelletier/go-toml/v2 v2.1.1 // indirect github.com/pkg/errors v0.9.1 // indirect github.com/pkg/sftp v1.13.6 // indirect - github.com/pmezard/go-difflib v1.0.0 // indirect + github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect github.com/power-devops/perfstat v0.0.0-20210106213030-5aafc221ea8c // indirect github.com/proglottis/gpgme v0.1.3 // indirect github.com/rivo/uniseg v0.4.4 // indirect @@ -218,6 +220,7 @@ require ( google.golang.org/genproto/googleapis/rpc v0.0.0-20231212172506-995d672761c0 // indirect google.golang.org/grpc v1.60.1 // indirect gopkg.in/go-jose/go-jose.v2 v2.6.1 // indirect + gopkg.in/natefinch/lumberjack.v2 v2.2.1 // indirect gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect tags.cncf.io/container-device-interface/specs-go v0.6.0 // indirect ) diff --git a/go.sum b/go.sum index daa5572109..f70d47dbdf 100644 --- a/go.sum +++ b/go.sum @@ -102,6 +102,8 @@ github.com/coreos/go-systemd/v22 v22.5.1-0.20231103132048-7d375ecc2b09/go.mod h1 github.com/coreos/stream-metadata-go v0.4.4 h1:PM/6iNhofKGydsatiY1zdnMMHBT34skb5P7nfEFR4GU= github.com/coreos/stream-metadata-go v0.4.4/go.mod h1:fMObQqQm8Ku91G04btKzEH3AsdP1mrAb986z9aaK0tE= github.com/cpuguy83/go-md2man/v2 v2.0.3/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o= +github.com/crc-org/crc/v2 v2.32.0 h1:I/62j5KrID8ua1vgAUPOVTtzhcsCsHWdqqiIRHySLfQ= +github.com/crc-org/crc/v2 v2.32.0/go.mod h1:Q2XJM3KkR/Gu+tBjeN77pk5P8DWYKdbxCSf+9l9MYcs= github.com/crc-org/vfkit v0.5.0 h1:co7N/3h5Jl29VfhPIvbF2cSG2bC7vC4DxbBVeppGPY0= github.com/crc-org/vfkit v0.5.0/go.mod h1:OQiqOghCzdgkd/jRoVu4/lcfQSKje7XPVpfW1aO9YvE= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= @@ -111,8 +113,9 @@ github.com/cyberphone/json-canonicalization v0.0.0-20231217050601-ba74d44ecf5f/g github.com/cyphar/filepath-securejoin v0.2.4 h1:Ugdm7cg7i6ZK6x3xDF1oEu1nfkyfH53EtKeQYTC3kyg= github.com/cyphar/filepath-securejoin v0.2.4/go.mod h1:aPGpWjXOXUn2NCNjFvBE6aRxGGx79pTxQpKOJNYHHl4= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc h1:U9qPSI2PIWSS1VwoXQT9A3Wy9MM3WgvqSxFWenqJduM= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/digitalocean/go-libvirt v0.0.0-20220804181439-8648fbde413e h1:SCnqm8SjSa0QqRxXbo5YY//S+OryeJioe17nK+iDZpg= github.com/digitalocean/go-libvirt v0.0.0-20220804181439-8648fbde413e/go.mod h1:o129ljs6alsIQTc8d6eweihqpmmrbxZ2g1jhgjhPykI= github.com/digitalocean/go-qemu v0.0.0-20230711162256-2e3d0186973e h1:x5PInTuXLddHWHlePCNAcM8QtUfOGx44f3UmYPMtDcI= @@ -345,8 +348,8 @@ github.com/klauspost/compress v1.13.6/go.mod h1:/3/Vjq9QcHkK5uEr5lBEmyoZ1iFhe47e github.com/klauspost/compress v1.17.5 h1:d4vBd+7CHydUqpFBgUEKkSdtSugf9YFmSkvUYPquI5E= github.com/klauspost/compress v1.17.5/go.mod h1:/dCuZOvVtNoHsyb+cuJD3itjs3NbnF6KH9zAO4BDxPM= github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= -github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.6 h1:ndNyv040zDGIDh8thGkXYjnFtiN02M1PVVF+JE/48xc= +github.com/klauspost/cpuid/v2 v2.2.6/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/klauspost/pgzip v1.2.6 h1:8RXeL5crjEUFnR2/Sn6GJNWtSQ3Dk8pq4CL3jvdDyjU= github.com/klauspost/pgzip v1.2.6/go.mod h1:Ch1tH69qFZu15pkjo5kYi6mth2Zzwzt50oCQKQE9RUs= github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M= @@ -380,6 +383,8 @@ github.com/manifoldco/promptui v0.9.0/go.mod h1:ka04sppxSGFAtxX0qhlYQjISsg9mR4GW github.com/markbates/oncer v0.0.0-20181203154359-bf2de49a0be2/go.mod h1:Ld9puTsIW75CHf65OeIOkyKbteujpZVXDpWK6YGZbxE= github.com/markbates/safe v1.0.1/go.mod h1:nAqgmRi7cY2nqMc92/bSEeQA+R4OheNU2T1kNSCBdG0= github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= +github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= +github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/mattn/go-isatty v0.0.19 h1:JITubQf0MOLdlGRuRq+jtsDlekdYPia9ZFsB8h/APPA= github.com/mattn/go-isatty v0.0.19/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y= github.com/mattn/go-runewidth v0.0.15 h1:UNAjwbU9l54TA3KzvqLGxwWjHmMgBUVhBiTjelZgg3U= @@ -471,8 +476,9 @@ github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/sftp v1.13.6 h1:JFZT4XbOU7l77xGSpOdW+pwIMqP044IyjXX6FGyEKFo= github.com/pkg/sftp v1.13.6/go.mod h1:tz1ryNURKu77RL+GuCzmoJYxQczL3wLNNpPWagdg4Qk= -github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/power-devops/perfstat v0.0.0-20210106213030-5aafc221ea8c h1:ncq/mPwQF4JjgDlrVEn3C11VoGHZN7m8qihwgMEtzYw= github.com/power-devops/perfstat v0.0.0-20210106213030-5aafc221ea8c/go.mod h1:OmDBASR4679mdNQnz2pUhc2G8CO2JrUAVFDRBDP/hJE= github.com/proglottis/gpgme v0.1.3 h1:Crxx0oz4LKB3QXc5Ea0J19K/3ICfy3ftr5exgUK1AU0= @@ -717,6 +723,7 @@ golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220622161953-175b2fd9d664/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220817070843-5a390386f1f2/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220908164124-27713097b956/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= @@ -808,6 +815,8 @@ gopkg.in/go-jose/go-jose.v2 v2.6.1 h1:qEzJlIDmG9q5VO0M/o8tGS65QMHMS1w01TQJB1VPJ4 gopkg.in/go-jose/go-jose.v2 v2.6.1/go.mod h1:zzZDPkNNw/c9IE7Z9jr11mBZQhKQTMzoEEIoEdZlFBI= gopkg.in/inf.v0 v0.9.1 h1:73M5CoZyi3ZLMOyDlQh031Cx6N9NDJ2Vvfl76EDAgDc= gopkg.in/inf.v0 v0.9.1/go.mod h1:cWUDdTG/fYaXco+Dcufb5Vnc6Gp2YChqWtbxRZE0mXw= +gopkg.in/natefinch/lumberjack.v2 v2.2.1 h1:bBRl1b0OH9s/DuPhuXpNl+VtCaJXFZ5/uEFST95x9zc= +gopkg.in/natefinch/lumberjack.v2 v2.2.1/go.mod h1:YD8tP3GAjkrDg1eZH7EGmyESg/lsYskCTPBJVb9jqSc= gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 h1:uRGJdciOHaEIrze2W8Q3AKkepLTh2hOroT7a+7czfdQ= gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7/go.mod h1:dt/ZhP58zS4L8KSrWDmTeBkI65Dw0HsyUHuEVlX15mw= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= @@ -826,16 +835,16 @@ gotest.tools v2.2.0+incompatible h1:VsBPFP1AI068pPrMxtb/S8Zkgf9xEmTLJjfM+P5UIEo= gotest.tools/v3 v3.5.1 h1:EENdUnS3pdur5nybKYIh2Vfgc8IUNBjxDPSjtiJcOzU= honnef.co/go/tools v0.0.0-20190102054323-c2f93a96b099/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4= honnef.co/go/tools v0.0.0-20190523083050-ea95bdfd59fc/go.mod h1:rf3lG4BRIbNafJWhAfAdb/ePZxsR/4RtNHQocxwk9r4= -k8s.io/apimachinery v0.26.5 h1:hTQVhJao2piX7vSgCn4Lwd6E0o/+TJIH4NqRf+q4EmE= +k8s.io/apimachinery v0.27.4 h1:CdxflD4AF61yewuid0fLl6bM4a3q04jWel0IlP+aYjs= k8s.io/klog v1.0.0 h1:Pt+yjF5aB1xDSVbau4VsWe+dQNzA0qv1LlXdC2dF6Q8= k8s.io/klog/v2 v2.100.1 h1:7WCHKK6K8fNhTqfBhISHQ97KrnJNFZMcQvKp7gP/tmg= k8s.io/kubernetes v1.28.4 h1:aRNxs5jb8FVTtlnxeA4FSDBVKuFwA8Gw40/U2zReBYA= k8s.io/kubernetes v1.28.4/go.mod h1:BTzDCKYAlu6LL9ITbfjwgwIrJ30hlTgbv0eXDoA/WoA= -k8s.io/utils v0.0.0-20230505201702-9f6742963106 h1:EObNQ3TW2D+WptiYXlApGNLVy0zm/JIBVY9i+M4wpAU= +k8s.io/utils v0.0.0-20230711102312-30195339c3c7 h1:ZgnF1KZsYxWIifwSNZFZgNtWE89WI5yiP5WwlfDoIyc= nullprogram.com/x/optparse v1.0.0/go.mod h1:KdyPE+Igbe0jQUrVfMqDMeJQIJZEuyV7pjYmp6pbG50= rsc.io/pdf v0.1.1/go.mod h1:n8OzWcQ6Sp37PL01nO98y4iUCRdTGarVfzxY20ICaU4= sigs.k8s.io/json v0.0.0-20221116044647-bc3834ca7abd h1:EDPBXCAspyGV4jQlpZSudPeMmr1bNJefnuqLsRAsHZo= -sigs.k8s.io/structured-merge-diff/v4 v4.2.3 h1:PRbqxJClWWYMNV1dhaG4NsibJbArud9kFxnAMREiWFE= +sigs.k8s.io/structured-merge-diff/v4 v4.3.0 h1:UZbZAZfX0wV2zr7YZorDz6GXROfDFj6LvqCRm4VUVKk= sigs.k8s.io/yaml v1.4.0 h1:Mk1wCc2gy/F0THH0TAp1QYyJNzRm2KCLy3o5ASXVI5E= sigs.k8s.io/yaml v1.4.0/go.mod h1:Ejl7/uTz7PSA4eKMyQCUTnhZYNmLIl+5c2lQPGR2BPY= src.elv.sh v0.16.0-rc1.0.20220116211855-fda62502ad7f h1:pjVeIo9Ba6K1Wy+rlwX91zT7A+xGEmxiNRBdN04gDTQ= diff --git a/pkg/machine/compression/copy_test.go b/pkg/machine/compression/copy_test.go deleted file mode 100644 index 9c25535ec5..0000000000 --- a/pkg/machine/compression/copy_test.go +++ /dev/null @@ -1,52 +0,0 @@ -package compression - -import ( - "os" - "path/filepath" - "testing" -) - -func TestCopyFile(t *testing.T) { - testStr := "test-machine" - - srcFile, err := os.CreateTemp("", "machine-test-") - if err != nil { - t.Fatal(err) - } - srcFi, err := srcFile.Stat() - if err != nil { - t.Fatal(err) - } - - _, _ = srcFile.Write([]byte(testStr)) //nolint:mirror - srcFile.Close() - - srcFilePath := filepath.Join(os.TempDir(), srcFi.Name()) - - destFile, err := os.CreateTemp("", "machine-copy-test-") - if err != nil { - t.Fatal(err) - } - - destFi, err := destFile.Stat() - if err != nil { - t.Fatal(err) - } - - destFile.Close() - - destFilePath := filepath.Join(os.TempDir(), destFi.Name()) - - if err := CopyFile(srcFilePath, destFilePath); err != nil { - t.Fatal(err) - } - - data, err := os.ReadFile(destFilePath) - if err != nil { - t.Fatal(err) - } - - if string(data) != testStr { - t.Fatalf("expected data \"%s\"; received \"%s\"", testStr, string(data)) - } -} diff --git a/pkg/machine/compression/decompress.go b/pkg/machine/compression/decompress.go index 4caca32b57..9f156a5a44 100644 --- a/pkg/machine/compression/decompress.go +++ b/pkg/machine/compression/decompress.go @@ -17,6 +17,7 @@ import ( "github.com/containers/podman/v4/pkg/machine/define" "github.com/containers/podman/v4/utils" "github.com/containers/storage/pkg/archive" + crcos "github.com/crc-org/crc/v2/pkg/os" "github.com/sirupsen/logrus" "github.com/ulikunitz/xz" ) @@ -26,7 +27,7 @@ import ( // called, the same uncompressed path is being opened multiple times. func Decompress(localPath *define.VMFile, uncompressedPath string) error { var isZip bool - uncompressedFileWriter, err := os.OpenFile(uncompressedPath, os.O_CREATE|os.O_RDWR, 0600) + uncompressedFileWriter, err := os.OpenFile(uncompressedPath, os.O_CREATE|os.O_RDWR, 0o600) if err != nil { return err } @@ -59,7 +60,7 @@ func Decompress(localPath *define.VMFile, uncompressedPath string) error { return err } fmt.Printf("Copying uncompressed file %q to %q/n", localPath.GetPath(), dstFile.Name()) - _, err = CopySparse(uncompressedFileWriter, dstFile) + _, err = crcos.CopySparse(uncompressedFileWriter, dstFile) return err case archive.Gzip: if runtime.GOOS == "darwin" { @@ -271,7 +272,7 @@ func decompressGzWithSparse(prefix string, compressedPath *define.VMFile, uncomp // }() logrus.Debugf("decompressing %s", compressedPath.GetPath()) - _, err = CopySparse(dstFile, gzReader) + _, err = crcos.CopySparse(dstFile, gzReader) logrus.Debug("decompression complete") // p.Wait() return err diff --git a/pkg/machine/e2e/machine_test.go b/pkg/machine/e2e/machine_test.go index 3ffe93e825..d582cf2341 100644 --- a/pkg/machine/e2e/machine_test.go +++ b/pkg/machine/e2e/machine_test.go @@ -18,6 +18,7 @@ import ( "github.com/containers/podman/v4/pkg/machine/provider" "github.com/containers/podman/v4/pkg/machine/vmconfigs" "github.com/containers/podman/v4/utils" + crcos "github.com/crc-org/crc/v2/pkg/os" . "github.com/onsi/ginkgo/v2" . "github.com/onsi/gomega" ) @@ -106,7 +107,6 @@ var _ = BeforeSuite(func() { Fail(fmt.Sprintf("unable to check for cache image: %q", err)) } } - }) var _ = SynchronizedAfterSuite(func() {}, func() {}) @@ -168,7 +168,7 @@ func setup() (string, *machineTestBuilder) { Fail(fmt.Sprintf("failed to copy %ss to %s: %q", fqImageName, mb.imagePath, err)) } } else { - if _, err := compression.CopySparse(dest, src); err != nil { + if _, err := crcos.CopySparse(dest, src); err != nil { Fail(fmt.Sprintf("failed to copy %q to %q: %q", src.Name(), dest.Name(), err)) } } diff --git a/vendor/github.com/crc-org/crc/v2/LICENSE b/vendor/github.com/crc-org/crc/v2/LICENSE new file mode 100644 index 0000000000..1405b983c0 --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/LICENSE @@ -0,0 +1,191 @@ + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + Copyright 2019 Red Hat, Inc. + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/inmemory.go b/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/inmemory.go new file mode 100644 index 0000000000..8d48f9256b --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/inmemory.go @@ -0,0 +1,44 @@ +package logging + +import ( + "container/ring" + "sync" + + "github.com/sirupsen/logrus" +) + +// This hook keeps in memory n messages from error to info level +type inMemoryHook struct { + messages *ring.Ring + lock sync.RWMutex +} + +func newInMemoryHook(size int) *inMemoryHook { + return &inMemoryHook{ + messages: ring.New(size), + } +} + +func (h *inMemoryHook) Levels() []logrus.Level { + return []logrus.Level{logrus.InfoLevel, logrus.WarnLevel, logrus.ErrorLevel} +} + +func (h *inMemoryHook) Fire(entry *logrus.Entry) error { + h.lock.Lock() + defer h.lock.Unlock() + h.messages.Value = entry.Message + h.messages = h.messages.Next() + return nil +} + +func (h *inMemoryHook) Messages() []string { + h.lock.RLock() + defer h.lock.RUnlock() + var ret []string + h.messages.Do(func(elem interface{}) { + if str, ok := elem.(string); ok { + ret = append(ret, str) + } + }) + return ret +} diff --git a/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/logging.go b/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/logging.go new file mode 100644 index 0000000000..a58ac42785 --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/logging.go @@ -0,0 +1,126 @@ +package logging + +import ( + "os" + + "github.com/sirupsen/logrus" + "github.com/spf13/pflag" + terminal "golang.org/x/term" + "gopkg.in/natefinch/lumberjack.v2" +) + +var ( + lumberjackLogger *lumberjack.Logger + logLevel = defaultLogLevel() + Memory = newInMemoryHook(100) +) + +func CloseLogging() { + if lumberjackLogger != nil { + _ = lumberjackLogger.Close() + } + logrus.StandardLogger().ReplaceHooks(make(logrus.LevelHooks)) +} + +func BackupLogFile() { + if lumberjackLogger == nil { + return + } + _ = lumberjackLogger.Rotate() +} + +func InitLogrus(logFilePath string) { + if lumberjackLogger != nil { + return + } + + lumberjackLogger = &lumberjack.Logger{ + Filename: logFilePath, + MaxSize: 5, // 5MB + MaxBackups: 2, + } + // send logs to file + logrus.SetOutput(lumberjackLogger) + + logrus.SetLevel(logrus.TraceLevel) + + level, err := logrus.ParseLevel(logLevel) + if err != nil { + level = logrus.InfoLevel + } + + logrus.AddHook(Memory) + + // Add hook to send error/fatal to stderr + logrus.AddHook(newstdErrHook(level, &logrus.TextFormatter{ + ForceColors: terminal.IsTerminal(int(os.Stderr.Fd())), + DisableTimestamp: true, + DisableLevelTruncation: false, + })) +} + +func DefaultLogLevel() logrus.Level { + level, err := logrus.ParseLevel(logLevel) + if err != nil { + level = logrus.InfoLevel + } + return level +} + +func defaultLogLevel() string { + defaultLevel := "info" + envLogLevel := os.Getenv("CRC_LOG_LEVEL") + if envLogLevel != "" { + defaultLevel = envLogLevel + } + + return defaultLevel +} + +func AddLogLevelFlag(flagset *pflag.FlagSet) { + flagset.StringVar(&logLevel, "log-level", defaultLogLevel(), "log level (e.g. \"debug | info | warn | error\")") +} + +func IsDebug() bool { + return logLevel == "debug" +} + +func Info(args ...interface{}) { + logrus.Info(args...) +} + +func Infof(s string, args ...interface{}) { + logrus.Infof(s, args...) +} + +func Warn(args ...interface{}) { + logrus.Warn(args...) +} + +func Warnf(s string, args ...interface{}) { + logrus.Warnf(s, args...) +} + +func Fatal(args ...interface{}) { + logrus.Fatal(args...) +} + +func Fatalf(s string, args ...interface{}) { + logrus.Fatalf(s, args...) +} + +func Error(args ...interface{}) { + logrus.Error(args...) +} + +func Errorf(s string, args ...interface{}) { + logrus.Errorf(s, args...) +} + +func Debug(args ...interface{}) { + logrus.Debug(args...) +} + +func Debugf(s string, args ...interface{}) { + logrus.Debugf(s, args...) +} diff --git a/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/stderr_hook.go b/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/stderr_hook.go new file mode 100644 index 0000000000..e9c593667f --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/crc/logging/stderr_hook.go @@ -0,0 +1,53 @@ +package logging + +import ( + "io" + "os" + "runtime" + + "github.com/mattn/go-colorable" + "github.com/sirupsen/logrus" +) + +// This is stdErrHook to send error to the stdErr. +type stdErrHook struct { + stderr io.Writer + formatter logrus.Formatter + level logrus.Level +} + +func newstdErrHook(level logrus.Level, formatter logrus.Formatter) *stdErrHook { + // For windows to display colors we need to use the go-colorable writer + if runtime.GOOS == "windows" { + return &stdErrHook{ + stderr: colorable.NewColorableStderr(), + formatter: formatter, + level: level, + } + } + return &stdErrHook{ + stderr: os.Stderr, + formatter: formatter, + level: level, + } +} + +func (h stdErrHook) Levels() []logrus.Level { + var levels []logrus.Level + for _, level := range logrus.AllLevels { + if level <= h.level { + levels = append(levels, level) + } + } + return levels +} + +func (h *stdErrHook) Fire(entry *logrus.Entry) error { + line, err := h.formatter.Format(entry) + if err != nil { + return err + } + + _, err = h.stderr.Write(line) + return err +} diff --git a/pkg/machine/compression/copy.go b/vendor/github.com/crc-org/crc/v2/pkg/os/copy.go similarity index 88% rename from pkg/machine/compression/copy.go rename to vendor/github.com/crc-org/crc/v2/pkg/os/copy.go index 2e4637865c..4c7d9e3a06 100644 --- a/pkg/machine/compression/copy.go +++ b/vendor/github.com/crc-org/crc/v2/pkg/os/copy.go @@ -1,4 +1,4 @@ -package compression +package os import ( "bytes" @@ -6,12 +6,6 @@ import ( "os" ) -// TODO vendor this in ... pkg/os directory is small and code should be negligible -/* - NOTE: copy.go and copy.test were lifted from github.com/crc-org/crc because - i was having trouble getting go to vendor it properly. all credit to them -*/ - func copyFile(src, dst string, sparse bool) error { in, err := os.Open(src) if err != nil { diff --git a/vendor/github.com/crc-org/crc/v2/pkg/os/exec.go b/vendor/github.com/crc-org/crc/v2/pkg/os/exec.go new file mode 100644 index 0000000000..130b1680da --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/os/exec.go @@ -0,0 +1,86 @@ +package os + +import ( + "bytes" + "errors" + "os" + "os/exec" + "strings" + + "github.com/crc-org/crc/v2/pkg/crc/logging" +) + +func runCmd(command string, args []string, env map[string]string) (string, string, error) { + cmd := exec.Command(command, args...) // #nosec G204 + if len(env) != 0 { + cmd.Env = os.Environ() + for key, value := range env { + cmd.Env = ReplaceOrAddEnv(cmd.Env, key, value) + } + } + stdOut := new(bytes.Buffer) + stdErr := new(bytes.Buffer) + cmd.Stdout = stdOut + cmd.Stderr = stdErr + err := cmd.Run() + if err != nil { + logging.Debugf("Command failed: %v", err) + logging.Debugf("stdout: %s", stdOut.String()) + logging.Debugf("stderr: %s", stdErr.String()) + } + return stdOut.String(), stdErr.String(), err +} + +func run(command string, args []string, env map[string]string) (string, string, error) { + logging.Debugf("Running '%s %s'", command, strings.Join(args, " ")) + return runCmd(command, args, env) +} + +func runPrivate(command string, args []string, env map[string]string) (string, string, error) { + logging.Debugf("Running '%s '", command) + return runCmd(command, args, env) +} + +// RunPrivileged executes a command using sudo +// provide a reason why root is needed as the first argument +func RunPrivileged(reason string, cmdAndArgs ...string) (string, string, error) { + sudo, err := exec.LookPath("sudo") + if err != nil { + return "", "", errors.New("sudo executable not found") + } + logging.Infof("Using root access: %s", reason) + return run(sudo, cmdAndArgs, map[string]string{}) +} + +var defaultLocaleEnv = map[string]string{"LC_ALL": "C", "LANG": "C"} + +func RunWithDefaultLocale(command string, args ...string) (string, string, error) { + return run(command, args, defaultLocaleEnv) +} + +func RunWithDefaultLocalePrivate(command string, args ...string) (string, string, error) { + return runPrivate(command, args, defaultLocaleEnv) +} + +type CommandRunner interface { + Run(command string, args ...string) (string, string, error) + RunPrivate(command string, args ...string) (string, string, error) + RunPrivileged(reason string, cmdAndArgs ...string) (string, string, error) +} +type localRunner struct{} + +func (r *localRunner) Run(command string, args ...string) (string, string, error) { + return RunWithDefaultLocale(command, args...) +} + +func (r *localRunner) RunPrivate(command string, args ...string) (string, string, error) { + return RunWithDefaultLocalePrivate(command, args...) +} + +func (r *localRunner) RunPrivileged(reason string, cmdAndArgs ...string) (string, string, error) { + return RunPrivileged(reason, cmdAndArgs...) +} + +func NewLocalCommandRunner() CommandRunner { + return &localRunner{} +} diff --git a/vendor/github.com/crc-org/crc/v2/pkg/os/execerror.go b/vendor/github.com/crc-org/crc/v2/pkg/os/execerror.go new file mode 100644 index 0000000000..303dd41bd3 --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/os/execerror.go @@ -0,0 +1,57 @@ +/* +Copyright 2014 The Kubernetes Authors. + +Licensed under the Apache License, Version 2.0 (the "License"); +you may not use this file except in compliance with the License. +You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + +Unless required by applicable law or agreed to in writing, software +distributed under the License is distributed on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +See the License for the specific language governing permissions and +limitations under the License. +*/ + +package os + +// ExitError is an interface that presents an API similar to os.ProcessState, which is +// what ExitError from os/exec is. This is designed to make testing a bit easier and +// probably loses some of the cross-platform properties of the underlying library. +type ExitError interface { + String() string + Error() string + Exited() bool + ExitStatus() int + Unwrap() error +} + +// CodeExitError is an implementation of ExitError consisting of an error object +// and an exit code (the upper bits of os.exec.ExitStatus). +type CodeExitError struct { + Err error + Code int +} + +var _ ExitError = CodeExitError{} + +func (e CodeExitError) Error() string { + return e.Err.Error() +} + +func (e CodeExitError) String() string { + return e.Err.Error() +} + +func (e CodeExitError) Exited() bool { + return true +} + +func (e CodeExitError) ExitStatus() int { + return e.Code +} + +func (e CodeExitError) Unwrap() error { + return e.Err +} diff --git a/vendor/github.com/crc-org/crc/v2/pkg/os/util.go b/vendor/github.com/crc-org/crc/v2/pkg/os/util.go new file mode 100644 index 0000000000..df097312c6 --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/os/util.go @@ -0,0 +1,129 @@ +package os + +import ( + "bytes" + "fmt" + "io" + "os" + "path/filepath" + "strings" + + "github.com/crc-org/crc/v2/pkg/crc/logging" +) + +// ReplaceOrAddEnv changes the value of an environment variable if it exists otherwise add the new variable +// It drops the existing value and appends the new value in-place +func ReplaceOrAddEnv(variables []string, varName string, value string) []string { + var result []string + + found := false + for _, e := range variables { + pair := strings.Split(e, "=") + if pair[0] != varName { + result = append(result, e) + } else { + found = true + result = append(result, fmt.Sprintf("%s=%s", varName, value)) + } + } + + if !found { + result = append(result, fmt.Sprintf("%s=%s", varName, value)) + } + return result +} + +func CopyFileContents(src string, dst string, permission os.FileMode) error { + logging.Debugf("Copying '%s' to '%s'", src, dst) + srcFile, err := os.Open(filepath.Clean(src)) + if err != nil { + return fmt.Errorf("[%v] Cannot open src file '%s'", err, src) + } + defer srcFile.Close() + + destFile, err := os.OpenFile(dst, os.O_RDWR|os.O_CREATE, permission) + if err != nil { + return fmt.Errorf("[%v] Cannot create dst file '%s'", err, dst) + } + defer destFile.Close() + + _, err = io.Copy(destFile, srcFile) + if err != nil { + return fmt.Errorf("[%v] Cannot copy '%s' to '%s'", err, src, dst) + } + + err = destFile.Sync() + if err != nil { + return fmt.Errorf("[%v] Cannot sync '%s' to '%s'", err, src, dst) + } + + return destFile.Close() +} + +func FileContentMatches(path string, expectedContent []byte) error { + _, err := os.Stat(path) + if err != nil { + return fmt.Errorf("File not found: %s: %s", path, err.Error()) + } + content, err := os.ReadFile(filepath.Clean(path)) + if err != nil { + return fmt.Errorf("Error opening file: %s: %s", path, err.Error()) + } + if !bytes.Equal(content, expectedContent) { + return fmt.Errorf("File has unexpected content: %s", path) + + } + return nil +} + +func WriteFileIfContentChanged(path string, newContent []byte, perm os.FileMode) (bool, error) { + err := FileContentMatches(path, newContent) + if err == nil { + return false, nil + } + + /* Intentionally ignore errors, just try to write the file if we can't read it */ + err = os.WriteFile(path, newContent, perm) + + if err != nil { + return false, err + } + return true, nil +} + +// FileExists returns true if the file at path exists. +// It returns false if it does not exist, or if there was an error when checking for its existence. +// This means there can be false negatives if Lstat fails because of permission issues (file exists, +// but is not reachable by the current user) +func FileExists(path string) bool { + info, err := os.Lstat(path) + if err != nil { + return false + } + return !info.IsDir() +} + +func RemoveFileIfExists(path string) error { + if FileExists(path) { + return os.Remove(path) + } + return nil +} + +func RunningUsingSSH() bool { + return os.Getenv("SSH_TTY") != "" +} + +// RemoveFileGlob takes a glob pattern as string to remove the files and directories that matches +func RemoveFileGlob(glob string) error { + matchedFiles, err := filepath.Glob(glob) + if err != nil { + return fmt.Errorf("Unable to find matches: %w", err) + } + for _, file := range matchedFiles { + if err = os.RemoveAll(file); err != nil { + return fmt.Errorf("Failed to delete file: %w", err) + } + } + return nil +} diff --git a/vendor/github.com/crc-org/crc/v2/pkg/os/util_unix.go b/vendor/github.com/crc-org/crc/v2/pkg/os/util_unix.go new file mode 100644 index 0000000000..0d1528166d --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/os/util_unix.go @@ -0,0 +1,48 @@ +//go:build !windows +// +build !windows + +package os + +import ( + "bytes" + "fmt" + "os" + "os/exec" + "os/user" + "strconv" + "strings" + + "github.com/crc-org/crc/v2/pkg/crc/logging" +) + +func WriteToFileAsRoot(reason, content, filepath string, mode os.FileMode) error { + logging.Infof("Using root access: %s", reason) + cmd := exec.Command("sudo", "tee", filepath) // #nosec G204 + cmd.Stdin = strings.NewReader(content) + buf := new(bytes.Buffer) + cmd.Stderr = buf + if err := cmd.Run(); err != nil { + return fmt.Errorf("Failed writing to file as root: %s: %s: %v", filepath, buf.String(), err) + } + if _, _, err := RunPrivileged(fmt.Sprintf("Changing permissions for %s to %o ", filepath, mode), + "chmod", strconv.FormatUint(uint64(mode), 8), filepath); err != nil { + return err + } + return nil +} + +func RemoveFileAsRoot(reason, filepath string) error { + if !FileExists(filepath) { + return nil + } + _, _, err := RunPrivileged(reason, "rm", "-fr", filepath) + return err +} + +func GetCurrentUsername() (string, error) { + u, err := user.Current() + if err != nil { + return "", err + } + return u.Username, nil +} diff --git a/vendor/github.com/crc-org/crc/v2/pkg/os/util_windows.go b/vendor/github.com/crc-org/crc/v2/pkg/os/util_windows.go new file mode 100644 index 0000000000..7d8f0e8313 --- /dev/null +++ b/vendor/github.com/crc-org/crc/v2/pkg/os/util_windows.go @@ -0,0 +1,46 @@ +package os + +import ( + "bytes" + "errors" + "io" + "os" + "os/user" + "strings" + + "golang.org/x/text/encoding/unicode" + "golang.org/x/text/transform" +) + +// ReadFileUTF16LE reads a UTF-16LE file and returns in a []byte +// ini/inf files in windows are of this format, reading a UTF-16 +// file directly without this would result in malformed texts +func ReadFileUTF16LE(filename string) ([]byte, error) { + // Read the file into a []byte + raw, err := os.ReadFile(filename) + if err != nil { + return nil, err + } + + // Make an tranformer that converts MS-Win default to UTF8 + win16le := unicode.UTF16(unicode.LittleEndian, unicode.IgnoreBOM) + // Make a transformer that is like win16le, but abides by BOM + utf16bom := unicode.BOMOverride(win16le.NewDecoder()) + + // Make a Reader that uses utf16bom + unicodeReader := transform.NewReader(bytes.NewReader(raw), utf16bom) + decoded, err := io.ReadAll(unicodeReader) + return decoded, err +} + +func GetCurrentUsername() (string, error) { + u, err := user.Current() + if err != nil { + return "", err + } + userAndDomain := strings.Split(u.Username, "\\") + if len(userAndDomain) > 1 { + return userAndDomain[1], nil + } + return "", errors.New("unable to find the username of current user") +} diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index accd7abaf9..30f8d2963e 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c Package home: https://github.com/klauspost/cpuid [![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2) -[![Build Status][3]][4] - -[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master -[4]: https://travis-ci.org/klauspost/cpuid +[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml) ## installing @@ -285,7 +282,12 @@ Exit Code 1 | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | | AMXTILE | Tile architecture | +| APX_F | Intel APX | | AVX | AVX functions | +| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported | +| AVX10_128 | If set indicates that AVX10 128-bit vector support is present | +| AVX10_256 | If set indicates that AVX10 256-bit vector support is present | +| AVX10_512 | If set indicates that AVX10 512-bit vector support is present | | AVX2 | AVX2 functions | | AVX512BF16 | AVX-512 BFLOAT16 Instructions | | AVX512BITALG | AVX-512 Bit Algorithms | @@ -365,6 +367,8 @@ Exit Code 1 | IDPRED_CTRL | IPRED_DIS | | INT_WBINVD | WBINVD/WBNOINVD are interruptible. | | INVLPGB | NVLPGB and TLBSYNC instruction supported | +| KEYLOCKER | Key locker | +| KEYLOCKERW | Key locker wide | | LAHF | LAHF/SAHF in long mode | | LAM | If set, CPU supports Linear Address Masking | | LBRVIRT | LBR virtualization | @@ -380,7 +384,7 @@ Exit Code 1 | MOVDIRI | Move Doubleword as Direct Store | | MOVSB_ZL | Fast Zero-Length MOVSB | | MPX | Intel MPX (Memory Protection Extensions) | -| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | | MSRIRC | Instruction Retired Counter MSR available | | MSRLIST | Read/Write List of Model Specific Registers | | MSR_PAGEFLUSH | Page Flush MSR available | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index d015c744e8..15b760337a 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -76,7 +76,12 @@ const ( AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers AMXTILE // Tile architecture + APX_F // Intel APX AVX // AVX functions + AVX10 // If set the Intel AVX10 Converged Vector ISA is supported + AVX10_128 // If set indicates that AVX10 128-bit vector support is present + AVX10_256 // If set indicates that AVX10 256-bit vector support is present + AVX10_512 // If set indicates that AVX10 512-bit vector support is present AVX2 // AVX2 functions AVX512BF16 // AVX-512 BFLOAT16 Instructions AVX512BITALG // AVX-512 Bit Algorithms @@ -156,6 +161,8 @@ const ( IDPRED_CTRL // IPRED_DIS INT_WBINVD // WBINVD/WBNOINVD are interruptible. INVLPGB // NVLPGB and TLBSYNC instruction supported + KEYLOCKER // Key locker + KEYLOCKERW // Key locker wide LAHF // LAHF/SAHF in long mode LAM // If set, CPU supports Linear Address Masking LBRVIRT // LBR virtualization @@ -302,9 +309,10 @@ type CPUInfo struct { L2 int // L2 Cache (per core or shared). Will be -1 if undetected L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected } - SGX SGXSupport - maxFunc uint32 - maxExFunc uint32 + SGX SGXSupport + AVX10Level uint8 + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -1165,6 +1173,7 @@ func support() flagSet { fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<23) != 0, KEYLOCKER) fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<29) != 0, ENQCMD) @@ -1202,6 +1211,8 @@ func support() flagSet { fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + fs.setIf(edx1&(1<<19) != 0, AVX10) + fs.setIf(edx1&(1<<21) != 0, APX_F) // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { @@ -1252,6 +1263,19 @@ func support() flagSet { fs.setIf(edx&(1<<4) != 0, BHI_CTRL) fs.setIf(edx&(1<<5) != 0, MCDT_NO) + // Add keylocker features. + if fs.inSet(KEYLOCKER) && mfi >= 0x19 { + _, ebx, _, _ := cpuidex(0x19, 0) + fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4) + } + + // Add AVX10 features. + if fs.inSet(AVX10) && mfi >= 0x24 { + _, ebx, _, _ := cpuidex(0x24, 0) + fs.setIf(ebx&(1<<16) != 0, AVX10_128) + fs.setIf(ebx&(1<<17) != 0, AVX10_256) + fs.setIf(ebx&(1<<18) != 0, AVX10_512) + } } // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) @@ -1394,6 +1418,20 @@ func support() flagSet { fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } + if mfi >= 0x20 { + // Microsoft has decided to purposefully hide the information + // of the guest TEE when VMs are being created using Hyper-V. + // + // This leads us to check for the Hyper-V cpuid features + // (0x4000000C), and then for the `ebx` value set. + // + // For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part + // we're mostly interested about,according to: + // https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174 + _, ebx, _, _ := cpuid(0x4000000C) + fs.setIf(ebx == 0xbe3, TDX_GUEST) + } + if mfi >= 0x21 { // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). _, ebx, ecx, edx := cpuid(0x21) @@ -1404,6 +1442,14 @@ func support() flagSet { return fs } +func (c *CPUInfo) supportAVX10() uint8 { + if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) { + _, ebx, _, _ := cpuidex(0x24, 0) + return uint8(ebx) + } + return 0 +} + func valAsString(values ...uint32) []byte { r := make([]byte, 4*len(values)) for i, v := range values { diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index c946824ec0..c7dfa125de 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -31,6 +31,7 @@ func addInfo(c *CPUInfo, safe bool) { c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 024c706af5..43bd05f516 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -16,210 +16,217 @@ func _() { _ = x[AMXFP16-6] _ = x[AMXINT8-7] _ = x[AMXTILE-8] - _ = x[AVX-9] - _ = x[AVX2-10] - _ = x[AVX512BF16-11] - _ = x[AVX512BITALG-12] - _ = x[AVX512BW-13] - _ = x[AVX512CD-14] - _ = x[AVX512DQ-15] - _ = x[AVX512ER-16] - _ = x[AVX512F-17] - _ = x[AVX512FP16-18] - _ = x[AVX512IFMA-19] - _ = x[AVX512PF-20] - _ = x[AVX512VBMI-21] - _ = x[AVX512VBMI2-22] - _ = x[AVX512VL-23] - _ = x[AVX512VNNI-24] - _ = x[AVX512VP2INTERSECT-25] - _ = x[AVX512VPOPCNTDQ-26] - _ = x[AVXIFMA-27] - _ = x[AVXNECONVERT-28] - _ = x[AVXSLOW-29] - _ = x[AVXVNNI-30] - _ = x[AVXVNNIINT8-31] - _ = x[BHI_CTRL-32] - _ = x[BMI1-33] - _ = x[BMI2-34] - _ = x[CETIBT-35] - _ = x[CETSS-36] - _ = x[CLDEMOTE-37] - _ = x[CLMUL-38] - _ = x[CLZERO-39] - _ = x[CMOV-40] - _ = x[CMPCCXADD-41] - _ = x[CMPSB_SCADBS_SHORT-42] - _ = x[CMPXCHG8-43] - _ = x[CPBOOST-44] - _ = x[CPPC-45] - _ = x[CX16-46] - _ = x[EFER_LMSLE_UNS-47] - _ = x[ENQCMD-48] - _ = x[ERMS-49] - _ = x[F16C-50] - _ = x[FLUSH_L1D-51] - _ = x[FMA3-52] - _ = x[FMA4-53] - _ = x[FP128-54] - _ = x[FP256-55] - _ = x[FSRM-56] - _ = x[FXSR-57] - _ = x[FXSROPT-58] - _ = x[GFNI-59] - _ = x[HLE-60] - _ = x[HRESET-61] - _ = x[HTT-62] - _ = x[HWA-63] - _ = x[HYBRID_CPU-64] - _ = x[HYPERVISOR-65] - _ = x[IA32_ARCH_CAP-66] - _ = x[IA32_CORE_CAP-67] - _ = x[IBPB-68] - _ = x[IBRS-69] - _ = x[IBRS_PREFERRED-70] - _ = x[IBRS_PROVIDES_SMP-71] - _ = x[IBS-72] - _ = x[IBSBRNTRGT-73] - _ = x[IBSFETCHSAM-74] - _ = x[IBSFFV-75] - _ = x[IBSOPCNT-76] - _ = x[IBSOPCNTEXT-77] - _ = x[IBSOPSAM-78] - _ = x[IBSRDWROPCNT-79] - _ = x[IBSRIPINVALIDCHK-80] - _ = x[IBS_FETCH_CTLX-81] - _ = x[IBS_OPDATA4-82] - _ = x[IBS_OPFUSE-83] - _ = x[IBS_PREVENTHOST-84] - _ = x[IBS_ZEN4-85] - _ = x[IDPRED_CTRL-86] - _ = x[INT_WBINVD-87] - _ = x[INVLPGB-88] - _ = x[LAHF-89] - _ = x[LAM-90] - _ = x[LBRVIRT-91] - _ = x[LZCNT-92] - _ = x[MCAOVERFLOW-93] - _ = x[MCDT_NO-94] - _ = x[MCOMMIT-95] - _ = x[MD_CLEAR-96] - _ = x[MMX-97] - _ = x[MMXEXT-98] - _ = x[MOVBE-99] - _ = x[MOVDIR64B-100] - _ = x[MOVDIRI-101] - _ = x[MOVSB_ZL-102] - _ = x[MOVU-103] - _ = x[MPX-104] - _ = x[MSRIRC-105] - _ = x[MSRLIST-106] - _ = x[MSR_PAGEFLUSH-107] - _ = x[NRIPS-108] - _ = x[NX-109] - _ = x[OSXSAVE-110] - _ = x[PCONFIG-111] - _ = x[POPCNT-112] - _ = x[PPIN-113] - _ = x[PREFETCHI-114] - _ = x[PSFD-115] - _ = x[RDPRU-116] - _ = x[RDRAND-117] - _ = x[RDSEED-118] - _ = x[RDTSCP-119] - _ = x[RRSBA_CTRL-120] - _ = x[RTM-121] - _ = x[RTM_ALWAYS_ABORT-122] - _ = x[SERIALIZE-123] - _ = x[SEV-124] - _ = x[SEV_64BIT-125] - _ = x[SEV_ALTERNATIVE-126] - _ = x[SEV_DEBUGSWAP-127] - _ = x[SEV_ES-128] - _ = x[SEV_RESTRICTED-129] - _ = x[SEV_SNP-130] - _ = x[SGX-131] - _ = x[SGXLC-132] - _ = x[SHA-133] - _ = x[SME-134] - _ = x[SME_COHERENT-135] - _ = x[SPEC_CTRL_SSBD-136] - _ = x[SRBDS_CTRL-137] - _ = x[SSE-138] - _ = x[SSE2-139] - _ = x[SSE3-140] - _ = x[SSE4-141] - _ = x[SSE42-142] - _ = x[SSE4A-143] - _ = x[SSSE3-144] - _ = x[STIBP-145] - _ = x[STIBP_ALWAYSON-146] - _ = x[STOSB_SHORT-147] - _ = x[SUCCOR-148] - _ = x[SVM-149] - _ = x[SVMDA-150] - _ = x[SVMFBASID-151] - _ = x[SVML-152] - _ = x[SVMNP-153] - _ = x[SVMPF-154] - _ = x[SVMPFT-155] - _ = x[SYSCALL-156] - _ = x[SYSEE-157] - _ = x[TBM-158] - _ = x[TDX_GUEST-159] - _ = x[TLB_FLUSH_NESTED-160] - _ = x[TME-161] - _ = x[TOPEXT-162] - _ = x[TSCRATEMSR-163] - _ = x[TSXLDTRK-164] - _ = x[VAES-165] - _ = x[VMCBCLEAN-166] - _ = x[VMPL-167] - _ = x[VMSA_REGPROT-168] - _ = x[VMX-169] - _ = x[VPCLMULQDQ-170] - _ = x[VTE-171] - _ = x[WAITPKG-172] - _ = x[WBNOINVD-173] - _ = x[WRMSRNS-174] - _ = x[X87-175] - _ = x[XGETBV1-176] - _ = x[XOP-177] - _ = x[XSAVE-178] - _ = x[XSAVEC-179] - _ = x[XSAVEOPT-180] - _ = x[XSAVES-181] - _ = x[AESARM-182] - _ = x[ARMCPUID-183] - _ = x[ASIMD-184] - _ = x[ASIMDDP-185] - _ = x[ASIMDHP-186] - _ = x[ASIMDRDM-187] - _ = x[ATOMICS-188] - _ = x[CRC32-189] - _ = x[DCPOP-190] - _ = x[EVTSTRM-191] - _ = x[FCMA-192] - _ = x[FP-193] - _ = x[FPHP-194] - _ = x[GPA-195] - _ = x[JSCVT-196] - _ = x[LRCPC-197] - _ = x[PMULL-198] - _ = x[SHA1-199] - _ = x[SHA2-200] - _ = x[SHA3-201] - _ = x[SHA512-202] - _ = x[SM3-203] - _ = x[SM4-204] - _ = x[SVE-205] - _ = x[lastID-206] + _ = x[APX_F-9] + _ = x[AVX-10] + _ = x[AVX10-11] + _ = x[AVX10_128-12] + _ = x[AVX10_256-13] + _ = x[AVX10_512-14] + _ = x[AVX2-15] + _ = x[AVX512BF16-16] + _ = x[AVX512BITALG-17] + _ = x[AVX512BW-18] + _ = x[AVX512CD-19] + _ = x[AVX512DQ-20] + _ = x[AVX512ER-21] + _ = x[AVX512F-22] + _ = x[AVX512FP16-23] + _ = x[AVX512IFMA-24] + _ = x[AVX512PF-25] + _ = x[AVX512VBMI-26] + _ = x[AVX512VBMI2-27] + _ = x[AVX512VL-28] + _ = x[AVX512VNNI-29] + _ = x[AVX512VP2INTERSECT-30] + _ = x[AVX512VPOPCNTDQ-31] + _ = x[AVXIFMA-32] + _ = x[AVXNECONVERT-33] + _ = x[AVXSLOW-34] + _ = x[AVXVNNI-35] + _ = x[AVXVNNIINT8-36] + _ = x[BHI_CTRL-37] + _ = x[BMI1-38] + _ = x[BMI2-39] + _ = x[CETIBT-40] + _ = x[CETSS-41] + _ = x[CLDEMOTE-42] + _ = x[CLMUL-43] + _ = x[CLZERO-44] + _ = x[CMOV-45] + _ = x[CMPCCXADD-46] + _ = x[CMPSB_SCADBS_SHORT-47] + _ = x[CMPXCHG8-48] + _ = x[CPBOOST-49] + _ = x[CPPC-50] + _ = x[CX16-51] + _ = x[EFER_LMSLE_UNS-52] + _ = x[ENQCMD-53] + _ = x[ERMS-54] + _ = x[F16C-55] + _ = x[FLUSH_L1D-56] + _ = x[FMA3-57] + _ = x[FMA4-58] + _ = x[FP128-59] + _ = x[FP256-60] + _ = x[FSRM-61] + _ = x[FXSR-62] + _ = x[FXSROPT-63] + _ = x[GFNI-64] + _ = x[HLE-65] + _ = x[HRESET-66] + _ = x[HTT-67] + _ = x[HWA-68] + _ = x[HYBRID_CPU-69] + _ = x[HYPERVISOR-70] + _ = x[IA32_ARCH_CAP-71] + _ = x[IA32_CORE_CAP-72] + _ = x[IBPB-73] + _ = x[IBRS-74] + _ = x[IBRS_PREFERRED-75] + _ = x[IBRS_PROVIDES_SMP-76] + _ = x[IBS-77] + _ = x[IBSBRNTRGT-78] + _ = x[IBSFETCHSAM-79] + _ = x[IBSFFV-80] + _ = x[IBSOPCNT-81] + _ = x[IBSOPCNTEXT-82] + _ = x[IBSOPSAM-83] + _ = x[IBSRDWROPCNT-84] + _ = x[IBSRIPINVALIDCHK-85] + _ = x[IBS_FETCH_CTLX-86] + _ = x[IBS_OPDATA4-87] + _ = x[IBS_OPFUSE-88] + _ = x[IBS_PREVENTHOST-89] + _ = x[IBS_ZEN4-90] + _ = x[IDPRED_CTRL-91] + _ = x[INT_WBINVD-92] + _ = x[INVLPGB-93] + _ = x[KEYLOCKER-94] + _ = x[KEYLOCKERW-95] + _ = x[LAHF-96] + _ = x[LAM-97] + _ = x[LBRVIRT-98] + _ = x[LZCNT-99] + _ = x[MCAOVERFLOW-100] + _ = x[MCDT_NO-101] + _ = x[MCOMMIT-102] + _ = x[MD_CLEAR-103] + _ = x[MMX-104] + _ = x[MMXEXT-105] + _ = x[MOVBE-106] + _ = x[MOVDIR64B-107] + _ = x[MOVDIRI-108] + _ = x[MOVSB_ZL-109] + _ = x[MOVU-110] + _ = x[MPX-111] + _ = x[MSRIRC-112] + _ = x[MSRLIST-113] + _ = x[MSR_PAGEFLUSH-114] + _ = x[NRIPS-115] + _ = x[NX-116] + _ = x[OSXSAVE-117] + _ = x[PCONFIG-118] + _ = x[POPCNT-119] + _ = x[PPIN-120] + _ = x[PREFETCHI-121] + _ = x[PSFD-122] + _ = x[RDPRU-123] + _ = x[RDRAND-124] + _ = x[RDSEED-125] + _ = x[RDTSCP-126] + _ = x[RRSBA_CTRL-127] + _ = x[RTM-128] + _ = x[RTM_ALWAYS_ABORT-129] + _ = x[SERIALIZE-130] + _ = x[SEV-131] + _ = x[SEV_64BIT-132] + _ = x[SEV_ALTERNATIVE-133] + _ = x[SEV_DEBUGSWAP-134] + _ = x[SEV_ES-135] + _ = x[SEV_RESTRICTED-136] + _ = x[SEV_SNP-137] + _ = x[SGX-138] + _ = x[SGXLC-139] + _ = x[SHA-140] + _ = x[SME-141] + _ = x[SME_COHERENT-142] + _ = x[SPEC_CTRL_SSBD-143] + _ = x[SRBDS_CTRL-144] + _ = x[SSE-145] + _ = x[SSE2-146] + _ = x[SSE3-147] + _ = x[SSE4-148] + _ = x[SSE42-149] + _ = x[SSE4A-150] + _ = x[SSSE3-151] + _ = x[STIBP-152] + _ = x[STIBP_ALWAYSON-153] + _ = x[STOSB_SHORT-154] + _ = x[SUCCOR-155] + _ = x[SVM-156] + _ = x[SVMDA-157] + _ = x[SVMFBASID-158] + _ = x[SVML-159] + _ = x[SVMNP-160] + _ = x[SVMPF-161] + _ = x[SVMPFT-162] + _ = x[SYSCALL-163] + _ = x[SYSEE-164] + _ = x[TBM-165] + _ = x[TDX_GUEST-166] + _ = x[TLB_FLUSH_NESTED-167] + _ = x[TME-168] + _ = x[TOPEXT-169] + _ = x[TSCRATEMSR-170] + _ = x[TSXLDTRK-171] + _ = x[VAES-172] + _ = x[VMCBCLEAN-173] + _ = x[VMPL-174] + _ = x[VMSA_REGPROT-175] + _ = x[VMX-176] + _ = x[VPCLMULQDQ-177] + _ = x[VTE-178] + _ = x[WAITPKG-179] + _ = x[WBNOINVD-180] + _ = x[WRMSRNS-181] + _ = x[X87-182] + _ = x[XGETBV1-183] + _ = x[XOP-184] + _ = x[XSAVE-185] + _ = x[XSAVEC-186] + _ = x[XSAVEOPT-187] + _ = x[XSAVES-188] + _ = x[AESARM-189] + _ = x[ARMCPUID-190] + _ = x[ASIMD-191] + _ = x[ASIMDDP-192] + _ = x[ASIMDHP-193] + _ = x[ASIMDRDM-194] + _ = x[ATOMICS-195] + _ = x[CRC32-196] + _ = x[DCPOP-197] + _ = x[EVTSTRM-198] + _ = x[FCMA-199] + _ = x[FP-200] + _ = x[FPHP-201] + _ = x[GPA-202] + _ = x[JSCVT-203] + _ = x[LRCPC-204] + _ = x[PMULL-205] + _ = x[SHA1-206] + _ = x[SHA2-207] + _ = x[SHA3-208] + _ = x[SHA512-209] + _ = x[SM3-210] + _ = x[SM4-211] + _ = x[SVE-212] + _ = x[lastID-213] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 554, 568, 585, 588, 598, 609, 615, 623, 634, 642, 654, 670, 684, 695, 705, 720, 728, 739, 749, 756, 765, 775, 779, 782, 789, 794, 805, 812, 819, 827, 830, 836, 841, 850, 857, 865, 869, 872, 878, 885, 898, 903, 905, 912, 919, 925, 929, 938, 942, 947, 953, 959, 965, 975, 978, 994, 1003, 1006, 1015, 1030, 1043, 1049, 1063, 1070, 1073, 1078, 1081, 1084, 1096, 1110, 1120, 1123, 1127, 1131, 1135, 1140, 1145, 1150, 1155, 1169, 1180, 1186, 1189, 1194, 1203, 1207, 1212, 1217, 1223, 1230, 1235, 1238, 1247, 1263, 1266, 1272, 1282, 1290, 1294, 1303, 1307, 1319, 1322, 1332, 1335, 1342, 1350, 1357, 1360, 1367, 1370, 1375, 1381, 1389, 1395, 1401, 1409, 1414, 1421, 1428, 1436, 1443, 1448, 1453, 1460, 1464, 1466, 1470, 1473, 1478, 1483, 1488, 1492, 1496, 1500, 1506, 1509, 1512, 1515, 1521} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/mattn/go-colorable/LICENSE b/vendor/github.com/mattn/go-colorable/LICENSE new file mode 100644 index 0000000000..91b5cef30e --- /dev/null +++ b/vendor/github.com/mattn/go-colorable/LICENSE @@ -0,0 +1,21 @@ +The MIT License (MIT) + +Copyright (c) 2016 Yasuhiro Matsumoto + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. diff --git a/vendor/github.com/mattn/go-colorable/README.md b/vendor/github.com/mattn/go-colorable/README.md new file mode 100644 index 0000000000..ca0483711c --- /dev/null +++ b/vendor/github.com/mattn/go-colorable/README.md @@ -0,0 +1,48 @@ +# go-colorable + +[![Build Status](https://github.com/mattn/go-colorable/workflows/test/badge.svg)](https://github.com/mattn/go-colorable/actions?query=workflow%3Atest) +[![Codecov](https://codecov.io/gh/mattn/go-colorable/branch/master/graph/badge.svg)](https://codecov.io/gh/mattn/go-colorable) +[![GoDoc](https://godoc.org/github.com/mattn/go-colorable?status.svg)](http://godoc.org/github.com/mattn/go-colorable) +[![Go Report Card](https://goreportcard.com/badge/mattn/go-colorable)](https://goreportcard.com/report/mattn/go-colorable) + +Colorable writer for windows. + +For example, most of logger packages doesn't show colors on windows. (I know we can do it with ansicon. But I don't want.) +This package is possible to handle escape sequence for ansi color on windows. + +## Too Bad! + +![](https://raw.githubusercontent.com/mattn/go-colorable/gh-pages/bad.png) + + +## So Good! + +![](https://raw.githubusercontent.com/mattn/go-colorable/gh-pages/good.png) + +## Usage + +```go +logrus.SetFormatter(&logrus.TextFormatter{ForceColors: true}) +logrus.SetOutput(colorable.NewColorableStdout()) + +logrus.Info("succeeded") +logrus.Warn("not correct") +logrus.Error("something error") +logrus.Fatal("panic") +``` + +You can compile above code on non-windows OSs. + +## Installation + +``` +$ go get github.com/mattn/go-colorable +``` + +# License + +MIT + +# Author + +Yasuhiro Matsumoto (a.k.a mattn) diff --git a/vendor/github.com/mattn/go-colorable/colorable_appengine.go b/vendor/github.com/mattn/go-colorable/colorable_appengine.go new file mode 100644 index 0000000000..416d1bbbf8 --- /dev/null +++ b/vendor/github.com/mattn/go-colorable/colorable_appengine.go @@ -0,0 +1,38 @@ +//go:build appengine +// +build appengine + +package colorable + +import ( + "io" + "os" + + _ "github.com/mattn/go-isatty" +) + +// NewColorable returns new instance of Writer which handles escape sequence. +func NewColorable(file *os.File) io.Writer { + if file == nil { + panic("nil passed instead of *os.File to NewColorable()") + } + + return file +} + +// NewColorableStdout returns new instance of Writer which handles escape sequence for stdout. +func NewColorableStdout() io.Writer { + return os.Stdout +} + +// NewColorableStderr returns new instance of Writer which handles escape sequence for stderr. +func NewColorableStderr() io.Writer { + return os.Stderr +} + +// EnableColorsStdout enable colors if possible. +func EnableColorsStdout(enabled *bool) func() { + if enabled != nil { + *enabled = true + } + return func() {} +} diff --git a/vendor/github.com/mattn/go-colorable/colorable_others.go b/vendor/github.com/mattn/go-colorable/colorable_others.go new file mode 100644 index 0000000000..766d94603a --- /dev/null +++ b/vendor/github.com/mattn/go-colorable/colorable_others.go @@ -0,0 +1,38 @@ +//go:build !windows && !appengine +// +build !windows,!appengine + +package colorable + +import ( + "io" + "os" + + _ "github.com/mattn/go-isatty" +) + +// NewColorable returns new instance of Writer which handles escape sequence. +func NewColorable(file *os.File) io.Writer { + if file == nil { + panic("nil passed instead of *os.File to NewColorable()") + } + + return file +} + +// NewColorableStdout returns new instance of Writer which handles escape sequence for stdout. +func NewColorableStdout() io.Writer { + return os.Stdout +} + +// NewColorableStderr returns new instance of Writer which handles escape sequence for stderr. +func NewColorableStderr() io.Writer { + return os.Stderr +} + +// EnableColorsStdout enable colors if possible. +func EnableColorsStdout(enabled *bool) func() { + if enabled != nil { + *enabled = true + } + return func() {} +} diff --git a/vendor/github.com/mattn/go-colorable/colorable_windows.go b/vendor/github.com/mattn/go-colorable/colorable_windows.go new file mode 100644 index 0000000000..1846ad5ab4 --- /dev/null +++ b/vendor/github.com/mattn/go-colorable/colorable_windows.go @@ -0,0 +1,1047 @@ +//go:build windows && !appengine +// +build windows,!appengine + +package colorable + +import ( + "bytes" + "io" + "math" + "os" + "strconv" + "strings" + "sync" + "syscall" + "unsafe" + + "github.com/mattn/go-isatty" +) + +const ( + foregroundBlue = 0x1 + foregroundGreen = 0x2 + foregroundRed = 0x4 + foregroundIntensity = 0x8 + foregroundMask = (foregroundRed | foregroundBlue | foregroundGreen | foregroundIntensity) + backgroundBlue = 0x10 + backgroundGreen = 0x20 + backgroundRed = 0x40 + backgroundIntensity = 0x80 + backgroundMask = (backgroundRed | backgroundBlue | backgroundGreen | backgroundIntensity) + commonLvbUnderscore = 0x8000 + + cENABLE_VIRTUAL_TERMINAL_PROCESSING = 0x4 +) + +const ( + genericRead = 0x80000000 + genericWrite = 0x40000000 +) + +const ( + consoleTextmodeBuffer = 0x1 +) + +type wchar uint16 +type short int16 +type dword uint32 +type word uint16 + +type coord struct { + x short + y short +} + +type smallRect struct { + left short + top short + right short + bottom short +} + +type consoleScreenBufferInfo struct { + size coord + cursorPosition coord + attributes word + window smallRect + maximumWindowSize coord +} + +type consoleCursorInfo struct { + size dword + visible int32 +} + +var ( + kernel32 = syscall.NewLazyDLL("kernel32.dll") + procGetConsoleScreenBufferInfo = kernel32.NewProc("GetConsoleScreenBufferInfo") + procSetConsoleTextAttribute = kernel32.NewProc("SetConsoleTextAttribute") + procSetConsoleCursorPosition = kernel32.NewProc("SetConsoleCursorPosition") + procFillConsoleOutputCharacter = kernel32.NewProc("FillConsoleOutputCharacterW") + procFillConsoleOutputAttribute = kernel32.NewProc("FillConsoleOutputAttribute") + procGetConsoleCursorInfo = kernel32.NewProc("GetConsoleCursorInfo") + procSetConsoleCursorInfo = kernel32.NewProc("SetConsoleCursorInfo") + procSetConsoleTitle = kernel32.NewProc("SetConsoleTitleW") + procGetConsoleMode = kernel32.NewProc("GetConsoleMode") + procSetConsoleMode = kernel32.NewProc("SetConsoleMode") + procCreateConsoleScreenBuffer = kernel32.NewProc("CreateConsoleScreenBuffer") +) + +// Writer provides colorable Writer to the console +type Writer struct { + out io.Writer + handle syscall.Handle + althandle syscall.Handle + oldattr word + oldpos coord + rest bytes.Buffer + mutex sync.Mutex +} + +// NewColorable returns new instance of Writer which handles escape sequence from File. +func NewColorable(file *os.File) io.Writer { + if file == nil { + panic("nil passed instead of *os.File to NewColorable()") + } + + if isatty.IsTerminal(file.Fd()) { + var mode uint32 + if r, _, _ := procGetConsoleMode.Call(file.Fd(), uintptr(unsafe.Pointer(&mode))); r != 0 && mode&cENABLE_VIRTUAL_TERMINAL_PROCESSING != 0 { + return file + } + var csbi consoleScreenBufferInfo + handle := syscall.Handle(file.Fd()) + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + return &Writer{out: file, handle: handle, oldattr: csbi.attributes, oldpos: coord{0, 0}} + } + return file +} + +// NewColorableStdout returns new instance of Writer which handles escape sequence for stdout. +func NewColorableStdout() io.Writer { + return NewColorable(os.Stdout) +} + +// NewColorableStderr returns new instance of Writer which handles escape sequence for stderr. +func NewColorableStderr() io.Writer { + return NewColorable(os.Stderr) +} + +var color256 = map[int]int{ + 0: 0x000000, + 1: 0x800000, + 2: 0x008000, + 3: 0x808000, + 4: 0x000080, + 5: 0x800080, + 6: 0x008080, + 7: 0xc0c0c0, + 8: 0x808080, + 9: 0xff0000, + 10: 0x00ff00, + 11: 0xffff00, + 12: 0x0000ff, + 13: 0xff00ff, + 14: 0x00ffff, + 15: 0xffffff, + 16: 0x000000, + 17: 0x00005f, + 18: 0x000087, + 19: 0x0000af, + 20: 0x0000d7, + 21: 0x0000ff, + 22: 0x005f00, + 23: 0x005f5f, + 24: 0x005f87, + 25: 0x005faf, + 26: 0x005fd7, + 27: 0x005fff, + 28: 0x008700, + 29: 0x00875f, + 30: 0x008787, + 31: 0x0087af, + 32: 0x0087d7, + 33: 0x0087ff, + 34: 0x00af00, + 35: 0x00af5f, + 36: 0x00af87, + 37: 0x00afaf, + 38: 0x00afd7, + 39: 0x00afff, + 40: 0x00d700, + 41: 0x00d75f, + 42: 0x00d787, + 43: 0x00d7af, + 44: 0x00d7d7, + 45: 0x00d7ff, + 46: 0x00ff00, + 47: 0x00ff5f, + 48: 0x00ff87, + 49: 0x00ffaf, + 50: 0x00ffd7, + 51: 0x00ffff, + 52: 0x5f0000, + 53: 0x5f005f, + 54: 0x5f0087, + 55: 0x5f00af, + 56: 0x5f00d7, + 57: 0x5f00ff, + 58: 0x5f5f00, + 59: 0x5f5f5f, + 60: 0x5f5f87, + 61: 0x5f5faf, + 62: 0x5f5fd7, + 63: 0x5f5fff, + 64: 0x5f8700, + 65: 0x5f875f, + 66: 0x5f8787, + 67: 0x5f87af, + 68: 0x5f87d7, + 69: 0x5f87ff, + 70: 0x5faf00, + 71: 0x5faf5f, + 72: 0x5faf87, + 73: 0x5fafaf, + 74: 0x5fafd7, + 75: 0x5fafff, + 76: 0x5fd700, + 77: 0x5fd75f, + 78: 0x5fd787, + 79: 0x5fd7af, + 80: 0x5fd7d7, + 81: 0x5fd7ff, + 82: 0x5fff00, + 83: 0x5fff5f, + 84: 0x5fff87, + 85: 0x5fffaf, + 86: 0x5fffd7, + 87: 0x5fffff, + 88: 0x870000, + 89: 0x87005f, + 90: 0x870087, + 91: 0x8700af, + 92: 0x8700d7, + 93: 0x8700ff, + 94: 0x875f00, + 95: 0x875f5f, + 96: 0x875f87, + 97: 0x875faf, + 98: 0x875fd7, + 99: 0x875fff, + 100: 0x878700, + 101: 0x87875f, + 102: 0x878787, + 103: 0x8787af, + 104: 0x8787d7, + 105: 0x8787ff, + 106: 0x87af00, + 107: 0x87af5f, + 108: 0x87af87, + 109: 0x87afaf, + 110: 0x87afd7, + 111: 0x87afff, + 112: 0x87d700, + 113: 0x87d75f, + 114: 0x87d787, + 115: 0x87d7af, + 116: 0x87d7d7, + 117: 0x87d7ff, + 118: 0x87ff00, + 119: 0x87ff5f, + 120: 0x87ff87, + 121: 0x87ffaf, + 122: 0x87ffd7, + 123: 0x87ffff, + 124: 0xaf0000, + 125: 0xaf005f, + 126: 0xaf0087, + 127: 0xaf00af, + 128: 0xaf00d7, + 129: 0xaf00ff, + 130: 0xaf5f00, + 131: 0xaf5f5f, + 132: 0xaf5f87, + 133: 0xaf5faf, + 134: 0xaf5fd7, + 135: 0xaf5fff, + 136: 0xaf8700, + 137: 0xaf875f, + 138: 0xaf8787, + 139: 0xaf87af, + 140: 0xaf87d7, + 141: 0xaf87ff, + 142: 0xafaf00, + 143: 0xafaf5f, + 144: 0xafaf87, + 145: 0xafafaf, + 146: 0xafafd7, + 147: 0xafafff, + 148: 0xafd700, + 149: 0xafd75f, + 150: 0xafd787, + 151: 0xafd7af, + 152: 0xafd7d7, + 153: 0xafd7ff, + 154: 0xafff00, + 155: 0xafff5f, + 156: 0xafff87, + 157: 0xafffaf, + 158: 0xafffd7, + 159: 0xafffff, + 160: 0xd70000, + 161: 0xd7005f, + 162: 0xd70087, + 163: 0xd700af, + 164: 0xd700d7, + 165: 0xd700ff, + 166: 0xd75f00, + 167: 0xd75f5f, + 168: 0xd75f87, + 169: 0xd75faf, + 170: 0xd75fd7, + 171: 0xd75fff, + 172: 0xd78700, + 173: 0xd7875f, + 174: 0xd78787, + 175: 0xd787af, + 176: 0xd787d7, + 177: 0xd787ff, + 178: 0xd7af00, + 179: 0xd7af5f, + 180: 0xd7af87, + 181: 0xd7afaf, + 182: 0xd7afd7, + 183: 0xd7afff, + 184: 0xd7d700, + 185: 0xd7d75f, + 186: 0xd7d787, + 187: 0xd7d7af, + 188: 0xd7d7d7, + 189: 0xd7d7ff, + 190: 0xd7ff00, + 191: 0xd7ff5f, + 192: 0xd7ff87, + 193: 0xd7ffaf, + 194: 0xd7ffd7, + 195: 0xd7ffff, + 196: 0xff0000, + 197: 0xff005f, + 198: 0xff0087, + 199: 0xff00af, + 200: 0xff00d7, + 201: 0xff00ff, + 202: 0xff5f00, + 203: 0xff5f5f, + 204: 0xff5f87, + 205: 0xff5faf, + 206: 0xff5fd7, + 207: 0xff5fff, + 208: 0xff8700, + 209: 0xff875f, + 210: 0xff8787, + 211: 0xff87af, + 212: 0xff87d7, + 213: 0xff87ff, + 214: 0xffaf00, + 215: 0xffaf5f, + 216: 0xffaf87, + 217: 0xffafaf, + 218: 0xffafd7, + 219: 0xffafff, + 220: 0xffd700, + 221: 0xffd75f, + 222: 0xffd787, + 223: 0xffd7af, + 224: 0xffd7d7, + 225: 0xffd7ff, + 226: 0xffff00, + 227: 0xffff5f, + 228: 0xffff87, + 229: 0xffffaf, + 230: 0xffffd7, + 231: 0xffffff, + 232: 0x080808, + 233: 0x121212, + 234: 0x1c1c1c, + 235: 0x262626, + 236: 0x303030, + 237: 0x3a3a3a, + 238: 0x444444, + 239: 0x4e4e4e, + 240: 0x585858, + 241: 0x626262, + 242: 0x6c6c6c, + 243: 0x767676, + 244: 0x808080, + 245: 0x8a8a8a, + 246: 0x949494, + 247: 0x9e9e9e, + 248: 0xa8a8a8, + 249: 0xb2b2b2, + 250: 0xbcbcbc, + 251: 0xc6c6c6, + 252: 0xd0d0d0, + 253: 0xdadada, + 254: 0xe4e4e4, + 255: 0xeeeeee, +} + +// `\033]0;TITLESTR\007` +func doTitleSequence(er *bytes.Reader) error { + var c byte + var err error + + c, err = er.ReadByte() + if err != nil { + return err + } + if c != '0' && c != '2' { + return nil + } + c, err = er.ReadByte() + if err != nil { + return err + } + if c != ';' { + return nil + } + title := make([]byte, 0, 80) + for { + c, err = er.ReadByte() + if err != nil { + return err + } + if c == 0x07 || c == '\n' { + break + } + title = append(title, c) + } + if len(title) > 0 { + title8, err := syscall.UTF16PtrFromString(string(title)) + if err == nil { + procSetConsoleTitle.Call(uintptr(unsafe.Pointer(title8))) + } + } + return nil +} + +// returns Atoi(s) unless s == "" in which case it returns def +func atoiWithDefault(s string, def int) (int, error) { + if s == "" { + return def, nil + } + return strconv.Atoi(s) +} + +// Write writes data on console +func (w *Writer) Write(data []byte) (n int, err error) { + w.mutex.Lock() + defer w.mutex.Unlock() + var csbi consoleScreenBufferInfo + procGetConsoleScreenBufferInfo.Call(uintptr(w.handle), uintptr(unsafe.Pointer(&csbi))) + + handle := w.handle + + var er *bytes.Reader + if w.rest.Len() > 0 { + var rest bytes.Buffer + w.rest.WriteTo(&rest) + w.rest.Reset() + rest.Write(data) + er = bytes.NewReader(rest.Bytes()) + } else { + er = bytes.NewReader(data) + } + var plaintext bytes.Buffer +loop: + for { + c1, err := er.ReadByte() + if err != nil { + plaintext.WriteTo(w.out) + break loop + } + if c1 != 0x1b { + plaintext.WriteByte(c1) + continue + } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } + c2, err := er.ReadByte() + if err != nil { + break loop + } + + switch c2 { + case '>': + continue + case ']': + w.rest.WriteByte(c1) + w.rest.WriteByte(c2) + er.WriteTo(&w.rest) + if bytes.IndexByte(w.rest.Bytes(), 0x07) == -1 { + break loop + } + er = bytes.NewReader(w.rest.Bytes()[2:]) + err := doTitleSequence(er) + if err != nil { + break loop + } + w.rest.Reset() + continue + // https://github.com/mattn/go-colorable/issues/27 + case '7': + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + w.oldpos = csbi.cursorPosition + continue + case '8': + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&w.oldpos))) + continue + case 0x5b: + // execute part after switch + default: + continue + } + + w.rest.WriteByte(c1) + w.rest.WriteByte(c2) + er.WriteTo(&w.rest) + + var buf bytes.Buffer + var m byte + for i, c := range w.rest.Bytes()[2:] { + if ('a' <= c && c <= 'z') || ('A' <= c && c <= 'Z') || c == '@' { + m = c + er = bytes.NewReader(w.rest.Bytes()[2+i+1:]) + w.rest.Reset() + break + } + buf.Write([]byte(string(c))) + } + if m == 0 { + break loop + } + + switch m { + case 'A': + n, err = atoiWithDefault(buf.String(), 1) + if err != nil { + continue + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + csbi.cursorPosition.y -= short(n) + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'B': + n, err = atoiWithDefault(buf.String(), 1) + if err != nil { + continue + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + csbi.cursorPosition.y += short(n) + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'C': + n, err = atoiWithDefault(buf.String(), 1) + if err != nil { + continue + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + csbi.cursorPosition.x += short(n) + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'D': + n, err = atoiWithDefault(buf.String(), 1) + if err != nil { + continue + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + csbi.cursorPosition.x -= short(n) + if csbi.cursorPosition.x < 0 { + csbi.cursorPosition.x = 0 + } + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'E': + n, err = strconv.Atoi(buf.String()) + if err != nil { + continue + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + csbi.cursorPosition.x = 0 + csbi.cursorPosition.y += short(n) + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'F': + n, err = strconv.Atoi(buf.String()) + if err != nil { + continue + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + csbi.cursorPosition.x = 0 + csbi.cursorPosition.y -= short(n) + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'G': + n, err = strconv.Atoi(buf.String()) + if err != nil { + continue + } + if n < 1 { + n = 1 + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + csbi.cursorPosition.x = short(n - 1) + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'H', 'f': + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + if buf.Len() > 0 { + token := strings.Split(buf.String(), ";") + switch len(token) { + case 1: + n1, err := strconv.Atoi(token[0]) + if err != nil { + continue + } + csbi.cursorPosition.y = short(n1 - 1) + case 2: + n1, err := strconv.Atoi(token[0]) + if err != nil { + continue + } + n2, err := strconv.Atoi(token[1]) + if err != nil { + continue + } + csbi.cursorPosition.x = short(n2 - 1) + csbi.cursorPosition.y = short(n1 - 1) + } + } else { + csbi.cursorPosition.y = 0 + } + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) + case 'J': + n := 0 + if buf.Len() > 0 { + n, err = strconv.Atoi(buf.String()) + if err != nil { + continue + } + } + var count, written dword + var cursor coord + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + switch n { + case 0: + cursor = coord{x: csbi.cursorPosition.x, y: csbi.cursorPosition.y} + count = dword(csbi.size.x) - dword(csbi.cursorPosition.x) + dword(csbi.size.y-csbi.cursorPosition.y)*dword(csbi.size.x) + case 1: + cursor = coord{x: csbi.window.left, y: csbi.window.top} + count = dword(csbi.size.x) - dword(csbi.cursorPosition.x) + dword(csbi.window.top-csbi.cursorPosition.y)*dword(csbi.size.x) + case 2: + cursor = coord{x: csbi.window.left, y: csbi.window.top} + count = dword(csbi.size.x) - dword(csbi.cursorPosition.x) + dword(csbi.size.y-csbi.cursorPosition.y)*dword(csbi.size.x) + } + procFillConsoleOutputCharacter.Call(uintptr(handle), uintptr(' '), uintptr(count), *(*uintptr)(unsafe.Pointer(&cursor)), uintptr(unsafe.Pointer(&written))) + procFillConsoleOutputAttribute.Call(uintptr(handle), uintptr(csbi.attributes), uintptr(count), *(*uintptr)(unsafe.Pointer(&cursor)), uintptr(unsafe.Pointer(&written))) + case 'K': + n := 0 + if buf.Len() > 0 { + n, err = strconv.Atoi(buf.String()) + if err != nil { + continue + } + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + var cursor coord + var count, written dword + switch n { + case 0: + cursor = coord{x: csbi.cursorPosition.x, y: csbi.cursorPosition.y} + count = dword(csbi.size.x - csbi.cursorPosition.x) + case 1: + cursor = coord{x: csbi.window.left, y: csbi.cursorPosition.y} + count = dword(csbi.size.x - csbi.cursorPosition.x) + case 2: + cursor = coord{x: csbi.window.left, y: csbi.cursorPosition.y} + count = dword(csbi.size.x) + } + procFillConsoleOutputCharacter.Call(uintptr(handle), uintptr(' '), uintptr(count), *(*uintptr)(unsafe.Pointer(&cursor)), uintptr(unsafe.Pointer(&written))) + procFillConsoleOutputAttribute.Call(uintptr(handle), uintptr(csbi.attributes), uintptr(count), *(*uintptr)(unsafe.Pointer(&cursor)), uintptr(unsafe.Pointer(&written))) + case 'X': + n := 0 + if buf.Len() > 0 { + n, err = strconv.Atoi(buf.String()) + if err != nil { + continue + } + } + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + var cursor coord + var written dword + cursor = coord{x: csbi.cursorPosition.x, y: csbi.cursorPosition.y} + procFillConsoleOutputCharacter.Call(uintptr(handle), uintptr(' '), uintptr(n), *(*uintptr)(unsafe.Pointer(&cursor)), uintptr(unsafe.Pointer(&written))) + procFillConsoleOutputAttribute.Call(uintptr(handle), uintptr(csbi.attributes), uintptr(n), *(*uintptr)(unsafe.Pointer(&cursor)), uintptr(unsafe.Pointer(&written))) + case 'm': + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + attr := csbi.attributes + cs := buf.String() + if cs == "" { + procSetConsoleTextAttribute.Call(uintptr(handle), uintptr(w.oldattr)) + continue + } + token := strings.Split(cs, ";") + for i := 0; i < len(token); i++ { + ns := token[i] + if n, err = strconv.Atoi(ns); err == nil { + switch { + case n == 0 || n == 100: + attr = w.oldattr + case n == 4: + attr |= commonLvbUnderscore + case (1 <= n && n <= 3) || n == 5: + attr |= foregroundIntensity + case n == 7 || n == 27: + attr = + (attr &^ (foregroundMask | backgroundMask)) | + ((attr & foregroundMask) << 4) | + ((attr & backgroundMask) >> 4) + case n == 22: + attr &^= foregroundIntensity + case n == 24: + attr &^= commonLvbUnderscore + case 30 <= n && n <= 37: + attr &= backgroundMask + if (n-30)&1 != 0 { + attr |= foregroundRed + } + if (n-30)&2 != 0 { + attr |= foregroundGreen + } + if (n-30)&4 != 0 { + attr |= foregroundBlue + } + case n == 38: // set foreground color. + if i < len(token)-2 && (token[i+1] == "5" || token[i+1] == "05") { + if n256, err := strconv.Atoi(token[i+2]); err == nil { + if n256foreAttr == nil { + n256setup() + } + attr &= backgroundMask + attr |= n256foreAttr[n256%len(n256foreAttr)] + i += 2 + } + } else if len(token) == 5 && token[i+1] == "2" { + var r, g, b int + r, _ = strconv.Atoi(token[i+2]) + g, _ = strconv.Atoi(token[i+3]) + b, _ = strconv.Atoi(token[i+4]) + i += 4 + if r > 127 { + attr |= foregroundRed + } + if g > 127 { + attr |= foregroundGreen + } + if b > 127 { + attr |= foregroundBlue + } + } else { + attr = attr & (w.oldattr & backgroundMask) + } + case n == 39: // reset foreground color. + attr &= backgroundMask + attr |= w.oldattr & foregroundMask + case 40 <= n && n <= 47: + attr &= foregroundMask + if (n-40)&1 != 0 { + attr |= backgroundRed + } + if (n-40)&2 != 0 { + attr |= backgroundGreen + } + if (n-40)&4 != 0 { + attr |= backgroundBlue + } + case n == 48: // set background color. + if i < len(token)-2 && token[i+1] == "5" { + if n256, err := strconv.Atoi(token[i+2]); err == nil { + if n256backAttr == nil { + n256setup() + } + attr &= foregroundMask + attr |= n256backAttr[n256%len(n256backAttr)] + i += 2 + } + } else if len(token) == 5 && token[i+1] == "2" { + var r, g, b int + r, _ = strconv.Atoi(token[i+2]) + g, _ = strconv.Atoi(token[i+3]) + b, _ = strconv.Atoi(token[i+4]) + i += 4 + if r > 127 { + attr |= backgroundRed + } + if g > 127 { + attr |= backgroundGreen + } + if b > 127 { + attr |= backgroundBlue + } + } else { + attr = attr & (w.oldattr & foregroundMask) + } + case n == 49: // reset foreground color. + attr &= foregroundMask + attr |= w.oldattr & backgroundMask + case 90 <= n && n <= 97: + attr = (attr & backgroundMask) + attr |= foregroundIntensity + if (n-90)&1 != 0 { + attr |= foregroundRed + } + if (n-90)&2 != 0 { + attr |= foregroundGreen + } + if (n-90)&4 != 0 { + attr |= foregroundBlue + } + case 100 <= n && n <= 107: + attr = (attr & foregroundMask) + attr |= backgroundIntensity + if (n-100)&1 != 0 { + attr |= backgroundRed + } + if (n-100)&2 != 0 { + attr |= backgroundGreen + } + if (n-100)&4 != 0 { + attr |= backgroundBlue + } + } + procSetConsoleTextAttribute.Call(uintptr(handle), uintptr(attr)) + } + } + case 'h': + var ci consoleCursorInfo + cs := buf.String() + if cs == "5>" { + procGetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + ci.visible = 0 + procSetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + } else if cs == "?25" { + procGetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + ci.visible = 1 + procSetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + } else if cs == "?1049" { + if w.althandle == 0 { + h, _, _ := procCreateConsoleScreenBuffer.Call(uintptr(genericRead|genericWrite), 0, 0, uintptr(consoleTextmodeBuffer), 0, 0) + w.althandle = syscall.Handle(h) + if w.althandle != 0 { + handle = w.althandle + } + } + } + case 'l': + var ci consoleCursorInfo + cs := buf.String() + if cs == "5>" { + procGetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + ci.visible = 1 + procSetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + } else if cs == "?25" { + procGetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + ci.visible = 0 + procSetConsoleCursorInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&ci))) + } else if cs == "?1049" { + if w.althandle != 0 { + syscall.CloseHandle(w.althandle) + w.althandle = 0 + handle = w.handle + } + } + case 's': + procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) + w.oldpos = csbi.cursorPosition + case 'u': + procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&w.oldpos))) + } + } + + return len(data), nil +} + +type consoleColor struct { + rgb int + red bool + green bool + blue bool + intensity bool +} + +func (c consoleColor) foregroundAttr() (attr word) { + if c.red { + attr |= foregroundRed + } + if c.green { + attr |= foregroundGreen + } + if c.blue { + attr |= foregroundBlue + } + if c.intensity { + attr |= foregroundIntensity + } + return +} + +func (c consoleColor) backgroundAttr() (attr word) { + if c.red { + attr |= backgroundRed + } + if c.green { + attr |= backgroundGreen + } + if c.blue { + attr |= backgroundBlue + } + if c.intensity { + attr |= backgroundIntensity + } + return +} + +var color16 = []consoleColor{ + {0x000000, false, false, false, false}, + {0x000080, false, false, true, false}, + {0x008000, false, true, false, false}, + {0x008080, false, true, true, false}, + {0x800000, true, false, false, false}, + {0x800080, true, false, true, false}, + {0x808000, true, true, false, false}, + {0xc0c0c0, true, true, true, false}, + {0x808080, false, false, false, true}, + {0x0000ff, false, false, true, true}, + {0x00ff00, false, true, false, true}, + {0x00ffff, false, true, true, true}, + {0xff0000, true, false, false, true}, + {0xff00ff, true, false, true, true}, + {0xffff00, true, true, false, true}, + {0xffffff, true, true, true, true}, +} + +type hsv struct { + h, s, v float32 +} + +func (a hsv) dist(b hsv) float32 { + dh := a.h - b.h + switch { + case dh > 0.5: + dh = 1 - dh + case dh < -0.5: + dh = -1 - dh + } + ds := a.s - b.s + dv := a.v - b.v + return float32(math.Sqrt(float64(dh*dh + ds*ds + dv*dv))) +} + +func toHSV(rgb int) hsv { + r, g, b := float32((rgb&0xFF0000)>>16)/256.0, + float32((rgb&0x00FF00)>>8)/256.0, + float32(rgb&0x0000FF)/256.0 + min, max := minmax3f(r, g, b) + h := max - min + if h > 0 { + if max == r { + h = (g - b) / h + if h < 0 { + h += 6 + } + } else if max == g { + h = 2 + (b-r)/h + } else { + h = 4 + (r-g)/h + } + } + h /= 6.0 + s := max - min + if max != 0 { + s /= max + } + v := max + return hsv{h: h, s: s, v: v} +} + +type hsvTable []hsv + +func toHSVTable(rgbTable []consoleColor) hsvTable { + t := make(hsvTable, len(rgbTable)) + for i, c := range rgbTable { + t[i] = toHSV(c.rgb) + } + return t +} + +func (t hsvTable) find(rgb int) consoleColor { + hsv := toHSV(rgb) + n := 7 + l := float32(5.0) + for i, p := range t { + d := hsv.dist(p) + if d < l { + l, n = d, i + } + } + return color16[n] +} + +func minmax3f(a, b, c float32) (min, max float32) { + if a < b { + if b < c { + return a, c + } else if a < c { + return a, b + } else { + return c, b + } + } else { + if a < c { + return b, c + } else if b < c { + return b, a + } else { + return c, a + } + } +} + +var n256foreAttr []word +var n256backAttr []word + +func n256setup() { + n256foreAttr = make([]word, 256) + n256backAttr = make([]word, 256) + t := toHSVTable(color16) + for i, rgb := range color256 { + c := t.find(rgb) + n256foreAttr[i] = c.foregroundAttr() + n256backAttr[i] = c.backgroundAttr() + } +} + +// EnableColorsStdout enable colors if possible. +func EnableColorsStdout(enabled *bool) func() { + var mode uint32 + h := os.Stdout.Fd() + if r, _, _ := procGetConsoleMode.Call(h, uintptr(unsafe.Pointer(&mode))); r != 0 { + if r, _, _ = procSetConsoleMode.Call(h, uintptr(mode|cENABLE_VIRTUAL_TERMINAL_PROCESSING)); r != 0 { + if enabled != nil { + *enabled = true + } + return func() { + procSetConsoleMode.Call(h, uintptr(mode)) + } + } + } + if enabled != nil { + *enabled = true + } + return func() {} +} diff --git a/vendor/github.com/mattn/go-colorable/go.test.sh b/vendor/github.com/mattn/go-colorable/go.test.sh new file mode 100644 index 0000000000..012162b077 --- /dev/null +++ b/vendor/github.com/mattn/go-colorable/go.test.sh @@ -0,0 +1,12 @@ +#!/usr/bin/env bash + +set -e +echo "" > coverage.txt + +for d in $(go list ./... | grep -v vendor); do + go test -race -coverprofile=profile.out -covermode=atomic "$d" + if [ -f profile.out ]; then + cat profile.out >> coverage.txt + rm profile.out + fi +done diff --git a/vendor/github.com/mattn/go-colorable/noncolorable.go b/vendor/github.com/mattn/go-colorable/noncolorable.go new file mode 100644 index 0000000000..05d6f74bf6 --- /dev/null +++ b/vendor/github.com/mattn/go-colorable/noncolorable.go @@ -0,0 +1,57 @@ +package colorable + +import ( + "bytes" + "io" +) + +// NonColorable holds writer but removes escape sequence. +type NonColorable struct { + out io.Writer +} + +// NewNonColorable returns new instance of Writer which removes escape sequence from Writer. +func NewNonColorable(w io.Writer) io.Writer { + return &NonColorable{out: w} +} + +// Write writes data on console +func (w *NonColorable) Write(data []byte) (n int, err error) { + er := bytes.NewReader(data) + var plaintext bytes.Buffer +loop: + for { + c1, err := er.ReadByte() + if err != nil { + plaintext.WriteTo(w.out) + break loop + } + if c1 != 0x1b { + plaintext.WriteByte(c1) + continue + } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } + c2, err := er.ReadByte() + if err != nil { + break loop + } + if c2 != 0x5b { + continue + } + + for { + c, err := er.ReadByte() + if err != nil { + break loop + } + if ('a' <= c && c <= 'z') || ('A' <= c && c <= 'Z') || c == '@' { + break + } + } + } + + return len(data), nil +} diff --git a/vendor/gopkg.in/natefinch/lumberjack.v2/.gitignore b/vendor/gopkg.in/natefinch/lumberjack.v2/.gitignore new file mode 100644 index 0000000000..836562412f --- /dev/null +++ b/vendor/gopkg.in/natefinch/lumberjack.v2/.gitignore @@ -0,0 +1,23 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test diff --git a/vendor/gopkg.in/natefinch/lumberjack.v2/.travis.yml b/vendor/gopkg.in/natefinch/lumberjack.v2/.travis.yml new file mode 100644 index 0000000000..21166f5c7d --- /dev/null +++ b/vendor/gopkg.in/natefinch/lumberjack.v2/.travis.yml @@ -0,0 +1,11 @@ +language: go + +go: + - tip + - 1.15.x + - 1.14.x + - 1.13.x + - 1.12.x + +env: + - GO111MODULE=on diff --git a/vendor/gopkg.in/natefinch/lumberjack.v2/LICENSE b/vendor/gopkg.in/natefinch/lumberjack.v2/LICENSE new file mode 100644 index 0000000000..c3d4cc307d --- /dev/null +++ b/vendor/gopkg.in/natefinch/lumberjack.v2/LICENSE @@ -0,0 +1,21 @@ +The MIT License (MIT) + +Copyright (c) 2014 Nate Finch + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. \ No newline at end of file diff --git a/vendor/gopkg.in/natefinch/lumberjack.v2/README.md b/vendor/gopkg.in/natefinch/lumberjack.v2/README.md new file mode 100644 index 0000000000..060eae52a2 --- /dev/null +++ b/vendor/gopkg.in/natefinch/lumberjack.v2/README.md @@ -0,0 +1,179 @@ +# lumberjack [![GoDoc](https://godoc.org/gopkg.in/natefinch/lumberjack.v2?status.png)](https://godoc.org/gopkg.in/natefinch/lumberjack.v2) [![Build Status](https://travis-ci.org/natefinch/lumberjack.svg?branch=v2.0)](https://travis-ci.org/natefinch/lumberjack) [![Build status](https://ci.appveyor.com/api/projects/status/00gchpxtg4gkrt5d)](https://ci.appveyor.com/project/natefinch/lumberjack) [![Coverage Status](https://coveralls.io/repos/natefinch/lumberjack/badge.svg?branch=v2.0)](https://coveralls.io/r/natefinch/lumberjack?branch=v2.0) + +### Lumberjack is a Go package for writing logs to rolling files. + +Package lumberjack provides a rolling logger. + +Note that this is v2.0 of lumberjack, and should be imported using gopkg.in +thusly: + + import "gopkg.in/natefinch/lumberjack.v2" + +The package name remains simply lumberjack, and the code resides at +https://github.com/natefinch/lumberjack under the v2.0 branch. + +Lumberjack is intended to be one part of a logging infrastructure. +It is not an all-in-one solution, but instead is a pluggable +component at the bottom of the logging stack that simply controls the files +to which logs are written. + +Lumberjack plays well with any logging package that can write to an +io.Writer, including the standard library's log package. + +Lumberjack assumes that only one process is writing to the output files. +Using the same lumberjack configuration from multiple processes on the same +machine will result in improper behavior. + + +**Example** + +To use lumberjack with the standard library's log package, just pass it into the SetOutput function when your application starts. + +Code: + +```go +log.SetOutput(&lumberjack.Logger{ + Filename: "/var/log/myapp/foo.log", + MaxSize: 500, // megabytes + MaxBackups: 3, + MaxAge: 28, //days + Compress: true, // disabled by default +}) +``` + + + +## type Logger +``` go +type Logger struct { + // Filename is the file to write logs to. Backup log files will be retained + // in the same directory. It uses -lumberjack.log in + // os.TempDir() if empty. + Filename string `json:"filename" yaml:"filename"` + + // MaxSize is the maximum size in megabytes of the log file before it gets + // rotated. It defaults to 100 megabytes. + MaxSize int `json:"maxsize" yaml:"maxsize"` + + // MaxAge is the maximum number of days to retain old log files based on the + // timestamp encoded in their filename. Note that a day is defined as 24 + // hours and may not exactly correspond to calendar days due to daylight + // savings, leap seconds, etc. The default is not to remove old log files + // based on age. + MaxAge int `json:"maxage" yaml:"maxage"` + + // MaxBackups is the maximum number of old log files to retain. The default + // is to retain all old log files (though MaxAge may still cause them to get + // deleted.) + MaxBackups int `json:"maxbackups" yaml:"maxbackups"` + + // LocalTime determines if the time used for formatting the timestamps in + // backup files is the computer's local time. The default is to use UTC + // time. + LocalTime bool `json:"localtime" yaml:"localtime"` + + // Compress determines if the rotated log files should be compressed + // using gzip. The default is not to perform compression. + Compress bool `json:"compress" yaml:"compress"` + // contains filtered or unexported fields +} +``` +Logger is an io.WriteCloser that writes to the specified filename. + +Logger opens or creates the logfile on first Write. If the file exists and +is less than MaxSize megabytes, lumberjack will open and append to that file. +If the file exists and its size is >= MaxSize megabytes, the file is renamed +by putting the current time in a timestamp in the name immediately before the +file's extension (or the end of the filename if there's no extension). A new +log file is then created using original filename. + +Whenever a write would cause the current log file exceed MaxSize megabytes, +the current file is closed, renamed, and a new log file created with the +original name. Thus, the filename you give Logger is always the "current" log +file. + +Backups use the log file name given to Logger, in the form `name-timestamp.ext` +where name is the filename without the extension, timestamp is the time at which +the log was rotated formatted with the time.Time format of +`2006-01-02T15-04-05.000` and the extension is the original extension. For +example, if your Logger.Filename is `/var/log/foo/server.log`, a backup created +at 6:30pm on Nov 11 2016 would use the filename +`/var/log/foo/server-2016-11-04T18-30-00.000.log` + +### Cleaning Up Old Log Files +Whenever a new logfile gets created, old log files may be deleted. The most +recent files according to the encoded timestamp will be retained, up to a +number equal to MaxBackups (or all of them if MaxBackups is 0). Any files +with an encoded timestamp older than MaxAge days are deleted, regardless of +MaxBackups. Note that the time encoded in the timestamp is the rotation +time, which may differ from the last time that file was written to. + +If MaxBackups and MaxAge are both 0, no old log files will be deleted. + + + + + + + + + + + +### func (\*Logger) Close +``` go +func (l *Logger) Close() error +``` +Close implements io.Closer, and closes the current logfile. + + + +### func (\*Logger) Rotate +``` go +func (l *Logger) Rotate() error +``` +Rotate causes Logger to close the existing log file and immediately create a +new one. This is a helper function for applications that want to initiate +rotations outside of the normal rotation rules, such as in response to +SIGHUP. After rotating, this initiates a cleanup of old log files according +to the normal rules. + +**Example** + +Example of how to rotate in response to SIGHUP. + +Code: + +```go +l := &lumberjack.Logger{} +log.SetOutput(l) +c := make(chan os.Signal, 1) +signal.Notify(c, syscall.SIGHUP) + +go func() { + for { + <-c + l.Rotate() + } +}() +``` + +### func (\*Logger) Write +``` go +func (l *Logger) Write(p []byte) (n int, err error) +``` +Write implements io.Writer. If a write would cause the log file to be larger +than MaxSize, the file is closed, renamed to include a timestamp of the +current time, and a new log file is created using the original log file name. +If the length of the write is greater than MaxSize, an error is returned. + + + + + + + + + +- - - +Generated by [godoc2md](http://godoc.org/github.com/davecheney/godoc2md) diff --git a/vendor/gopkg.in/natefinch/lumberjack.v2/chown.go b/vendor/gopkg.in/natefinch/lumberjack.v2/chown.go new file mode 100644 index 0000000000..11d0669723 --- /dev/null +++ b/vendor/gopkg.in/natefinch/lumberjack.v2/chown.go @@ -0,0 +1,11 @@ +// +build !linux + +package lumberjack + +import ( + "os" +) + +func chown(_ string, _ os.FileInfo) error { + return nil +} diff --git a/vendor/gopkg.in/natefinch/lumberjack.v2/chown_linux.go b/vendor/gopkg.in/natefinch/lumberjack.v2/chown_linux.go new file mode 100644 index 0000000000..465f569270 --- /dev/null +++ b/vendor/gopkg.in/natefinch/lumberjack.v2/chown_linux.go @@ -0,0 +1,19 @@ +package lumberjack + +import ( + "os" + "syscall" +) + +// osChown is a var so we can mock it out during tests. +var osChown = os.Chown + +func chown(name string, info os.FileInfo) error { + f, err := os.OpenFile(name, os.O_CREATE|os.O_WRONLY|os.O_TRUNC, info.Mode()) + if err != nil { + return err + } + f.Close() + stat := info.Sys().(*syscall.Stat_t) + return osChown(name, int(stat.Uid), int(stat.Gid)) +} diff --git a/vendor/gopkg.in/natefinch/lumberjack.v2/lumberjack.go b/vendor/gopkg.in/natefinch/lumberjack.v2/lumberjack.go new file mode 100644 index 0000000000..3447cdc056 --- /dev/null +++ b/vendor/gopkg.in/natefinch/lumberjack.v2/lumberjack.go @@ -0,0 +1,541 @@ +// Package lumberjack provides a rolling logger. +// +// Note that this is v2.0 of lumberjack, and should be imported using gopkg.in +// thusly: +// +// import "gopkg.in/natefinch/lumberjack.v2" +// +// The package name remains simply lumberjack, and the code resides at +// https://github.com/natefinch/lumberjack under the v2.0 branch. +// +// Lumberjack is intended to be one part of a logging infrastructure. +// It is not an all-in-one solution, but instead is a pluggable +// component at the bottom of the logging stack that simply controls the files +// to which logs are written. +// +// Lumberjack plays well with any logging package that can write to an +// io.Writer, including the standard library's log package. +// +// Lumberjack assumes that only one process is writing to the output files. +// Using the same lumberjack configuration from multiple processes on the same +// machine will result in improper behavior. +package lumberjack + +import ( + "compress/gzip" + "errors" + "fmt" + "io" + "io/ioutil" + "os" + "path/filepath" + "sort" + "strings" + "sync" + "time" +) + +const ( + backupTimeFormat = "2006-01-02T15-04-05.000" + compressSuffix = ".gz" + defaultMaxSize = 100 +) + +// ensure we always implement io.WriteCloser +var _ io.WriteCloser = (*Logger)(nil) + +// Logger is an io.WriteCloser that writes to the specified filename. +// +// Logger opens or creates the logfile on first Write. If the file exists and +// is less than MaxSize megabytes, lumberjack will open and append to that file. +// If the file exists and its size is >= MaxSize megabytes, the file is renamed +// by putting the current time in a timestamp in the name immediately before the +// file's extension (or the end of the filename if there's no extension). A new +// log file is then created using original filename. +// +// Whenever a write would cause the current log file exceed MaxSize megabytes, +// the current file is closed, renamed, and a new log file created with the +// original name. Thus, the filename you give Logger is always the "current" log +// file. +// +// Backups use the log file name given to Logger, in the form +// `name-timestamp.ext` where name is the filename without the extension, +// timestamp is the time at which the log was rotated formatted with the +// time.Time format of `2006-01-02T15-04-05.000` and the extension is the +// original extension. For example, if your Logger.Filename is +// `/var/log/foo/server.log`, a backup created at 6:30pm on Nov 11 2016 would +// use the filename `/var/log/foo/server-2016-11-04T18-30-00.000.log` +// +// Cleaning Up Old Log Files +// +// Whenever a new logfile gets created, old log files may be deleted. The most +// recent files according to the encoded timestamp will be retained, up to a +// number equal to MaxBackups (or all of them if MaxBackups is 0). Any files +// with an encoded timestamp older than MaxAge days are deleted, regardless of +// MaxBackups. Note that the time encoded in the timestamp is the rotation +// time, which may differ from the last time that file was written to. +// +// If MaxBackups and MaxAge are both 0, no old log files will be deleted. +type Logger struct { + // Filename is the file to write logs to. Backup log files will be retained + // in the same directory. It uses -lumberjack.log in + // os.TempDir() if empty. + Filename string `json:"filename" yaml:"filename"` + + // MaxSize is the maximum size in megabytes of the log file before it gets + // rotated. It defaults to 100 megabytes. + MaxSize int `json:"maxsize" yaml:"maxsize"` + + // MaxAge is the maximum number of days to retain old log files based on the + // timestamp encoded in their filename. Note that a day is defined as 24 + // hours and may not exactly correspond to calendar days due to daylight + // savings, leap seconds, etc. The default is not to remove old log files + // based on age. + MaxAge int `json:"maxage" yaml:"maxage"` + + // MaxBackups is the maximum number of old log files to retain. The default + // is to retain all old log files (though MaxAge may still cause them to get + // deleted.) + MaxBackups int `json:"maxbackups" yaml:"maxbackups"` + + // LocalTime determines if the time used for formatting the timestamps in + // backup files is the computer's local time. The default is to use UTC + // time. + LocalTime bool `json:"localtime" yaml:"localtime"` + + // Compress determines if the rotated log files should be compressed + // using gzip. The default is not to perform compression. + Compress bool `json:"compress" yaml:"compress"` + + size int64 + file *os.File + mu sync.Mutex + + millCh chan bool + startMill sync.Once +} + +var ( + // currentTime exists so it can be mocked out by tests. + currentTime = time.Now + + // os_Stat exists so it can be mocked out by tests. + osStat = os.Stat + + // megabyte is the conversion factor between MaxSize and bytes. It is a + // variable so tests can mock it out and not need to write megabytes of data + // to disk. + megabyte = 1024 * 1024 +) + +// Write implements io.Writer. If a write would cause the log file to be larger +// than MaxSize, the file is closed, renamed to include a timestamp of the +// current time, and a new log file is created using the original log file name. +// If the length of the write is greater than MaxSize, an error is returned. +func (l *Logger) Write(p []byte) (n int, err error) { + l.mu.Lock() + defer l.mu.Unlock() + + writeLen := int64(len(p)) + if writeLen > l.max() { + return 0, fmt.Errorf( + "write length %d exceeds maximum file size %d", writeLen, l.max(), + ) + } + + if l.file == nil { + if err = l.openExistingOrNew(len(p)); err != nil { + return 0, err + } + } + + if l.size+writeLen > l.max() { + if err := l.rotate(); err != nil { + return 0, err + } + } + + n, err = l.file.Write(p) + l.size += int64(n) + + return n, err +} + +// Close implements io.Closer, and closes the current logfile. +func (l *Logger) Close() error { + l.mu.Lock() + defer l.mu.Unlock() + return l.close() +} + +// close closes the file if it is open. +func (l *Logger) close() error { + if l.file == nil { + return nil + } + err := l.file.Close() + l.file = nil + return err +} + +// Rotate causes Logger to close the existing log file and immediately create a +// new one. This is a helper function for applications that want to initiate +// rotations outside of the normal rotation rules, such as in response to +// SIGHUP. After rotating, this initiates compression and removal of old log +// files according to the configuration. +func (l *Logger) Rotate() error { + l.mu.Lock() + defer l.mu.Unlock() + return l.rotate() +} + +// rotate closes the current file, moves it aside with a timestamp in the name, +// (if it exists), opens a new file with the original filename, and then runs +// post-rotation processing and removal. +func (l *Logger) rotate() error { + if err := l.close(); err != nil { + return err + } + if err := l.openNew(); err != nil { + return err + } + l.mill() + return nil +} + +// openNew opens a new log file for writing, moving any old log file out of the +// way. This methods assumes the file has already been closed. +func (l *Logger) openNew() error { + err := os.MkdirAll(l.dir(), 0755) + if err != nil { + return fmt.Errorf("can't make directories for new logfile: %s", err) + } + + name := l.filename() + mode := os.FileMode(0600) + info, err := osStat(name) + if err == nil { + // Copy the mode off the old logfile. + mode = info.Mode() + // move the existing file + newname := backupName(name, l.LocalTime) + if err := os.Rename(name, newname); err != nil { + return fmt.Errorf("can't rename log file: %s", err) + } + + // this is a no-op anywhere but linux + if err := chown(name, info); err != nil { + return err + } + } + + // we use truncate here because this should only get called when we've moved + // the file ourselves. if someone else creates the file in the meantime, + // just wipe out the contents. + f, err := os.OpenFile(name, os.O_CREATE|os.O_WRONLY|os.O_TRUNC, mode) + if err != nil { + return fmt.Errorf("can't open new logfile: %s", err) + } + l.file = f + l.size = 0 + return nil +} + +// backupName creates a new filename from the given name, inserting a timestamp +// between the filename and the extension, using the local time if requested +// (otherwise UTC). +func backupName(name string, local bool) string { + dir := filepath.Dir(name) + filename := filepath.Base(name) + ext := filepath.Ext(filename) + prefix := filename[:len(filename)-len(ext)] + t := currentTime() + if !local { + t = t.UTC() + } + + timestamp := t.Format(backupTimeFormat) + return filepath.Join(dir, fmt.Sprintf("%s-%s%s", prefix, timestamp, ext)) +} + +// openExistingOrNew opens the logfile if it exists and if the current write +// would not put it over MaxSize. If there is no such file or the write would +// put it over the MaxSize, a new file is created. +func (l *Logger) openExistingOrNew(writeLen int) error { + l.mill() + + filename := l.filename() + info, err := osStat(filename) + if os.IsNotExist(err) { + return l.openNew() + } + if err != nil { + return fmt.Errorf("error getting log file info: %s", err) + } + + if info.Size()+int64(writeLen) >= l.max() { + return l.rotate() + } + + file, err := os.OpenFile(filename, os.O_APPEND|os.O_WRONLY, 0644) + if err != nil { + // if we fail to open the old log file for some reason, just ignore + // it and open a new log file. + return l.openNew() + } + l.file = file + l.size = info.Size() + return nil +} + +// filename generates the name of the logfile from the current time. +func (l *Logger) filename() string { + if l.Filename != "" { + return l.Filename + } + name := filepath.Base(os.Args[0]) + "-lumberjack.log" + return filepath.Join(os.TempDir(), name) +} + +// millRunOnce performs compression and removal of stale log files. +// Log files are compressed if enabled via configuration and old log +// files are removed, keeping at most l.MaxBackups files, as long as +// none of them are older than MaxAge. +func (l *Logger) millRunOnce() error { + if l.MaxBackups == 0 && l.MaxAge == 0 && !l.Compress { + return nil + } + + files, err := l.oldLogFiles() + if err != nil { + return err + } + + var compress, remove []logInfo + + if l.MaxBackups > 0 && l.MaxBackups < len(files) { + preserved := make(map[string]bool) + var remaining []logInfo + for _, f := range files { + // Only count the uncompressed log file or the + // compressed log file, not both. + fn := f.Name() + if strings.HasSuffix(fn, compressSuffix) { + fn = fn[:len(fn)-len(compressSuffix)] + } + preserved[fn] = true + + if len(preserved) > l.MaxBackups { + remove = append(remove, f) + } else { + remaining = append(remaining, f) + } + } + files = remaining + } + if l.MaxAge > 0 { + diff := time.Duration(int64(24*time.Hour) * int64(l.MaxAge)) + cutoff := currentTime().Add(-1 * diff) + + var remaining []logInfo + for _, f := range files { + if f.timestamp.Before(cutoff) { + remove = append(remove, f) + } else { + remaining = append(remaining, f) + } + } + files = remaining + } + + if l.Compress { + for _, f := range files { + if !strings.HasSuffix(f.Name(), compressSuffix) { + compress = append(compress, f) + } + } + } + + for _, f := range remove { + errRemove := os.Remove(filepath.Join(l.dir(), f.Name())) + if err == nil && errRemove != nil { + err = errRemove + } + } + for _, f := range compress { + fn := filepath.Join(l.dir(), f.Name()) + errCompress := compressLogFile(fn, fn+compressSuffix) + if err == nil && errCompress != nil { + err = errCompress + } + } + + return err +} + +// millRun runs in a goroutine to manage post-rotation compression and removal +// of old log files. +func (l *Logger) millRun() { + for range l.millCh { + // what am I going to do, log this? + _ = l.millRunOnce() + } +} + +// mill performs post-rotation compression and removal of stale log files, +// starting the mill goroutine if necessary. +func (l *Logger) mill() { + l.startMill.Do(func() { + l.millCh = make(chan bool, 1) + go l.millRun() + }) + select { + case l.millCh <- true: + default: + } +} + +// oldLogFiles returns the list of backup log files stored in the same +// directory as the current log file, sorted by ModTime +func (l *Logger) oldLogFiles() ([]logInfo, error) { + files, err := ioutil.ReadDir(l.dir()) + if err != nil { + return nil, fmt.Errorf("can't read log file directory: %s", err) + } + logFiles := []logInfo{} + + prefix, ext := l.prefixAndExt() + + for _, f := range files { + if f.IsDir() { + continue + } + if t, err := l.timeFromName(f.Name(), prefix, ext); err == nil { + logFiles = append(logFiles, logInfo{t, f}) + continue + } + if t, err := l.timeFromName(f.Name(), prefix, ext+compressSuffix); err == nil { + logFiles = append(logFiles, logInfo{t, f}) + continue + } + // error parsing means that the suffix at the end was not generated + // by lumberjack, and therefore it's not a backup file. + } + + sort.Sort(byFormatTime(logFiles)) + + return logFiles, nil +} + +// timeFromName extracts the formatted time from the filename by stripping off +// the filename's prefix and extension. This prevents someone's filename from +// confusing time.parse. +func (l *Logger) timeFromName(filename, prefix, ext string) (time.Time, error) { + if !strings.HasPrefix(filename, prefix) { + return time.Time{}, errors.New("mismatched prefix") + } + if !strings.HasSuffix(filename, ext) { + return time.Time{}, errors.New("mismatched extension") + } + ts := filename[len(prefix) : len(filename)-len(ext)] + return time.Parse(backupTimeFormat, ts) +} + +// max returns the maximum size in bytes of log files before rolling. +func (l *Logger) max() int64 { + if l.MaxSize == 0 { + return int64(defaultMaxSize * megabyte) + } + return int64(l.MaxSize) * int64(megabyte) +} + +// dir returns the directory for the current filename. +func (l *Logger) dir() string { + return filepath.Dir(l.filename()) +} + +// prefixAndExt returns the filename part and extension part from the Logger's +// filename. +func (l *Logger) prefixAndExt() (prefix, ext string) { + filename := filepath.Base(l.filename()) + ext = filepath.Ext(filename) + prefix = filename[:len(filename)-len(ext)] + "-" + return prefix, ext +} + +// compressLogFile compresses the given log file, removing the +// uncompressed log file if successful. +func compressLogFile(src, dst string) (err error) { + f, err := os.Open(src) + if err != nil { + return fmt.Errorf("failed to open log file: %v", err) + } + defer f.Close() + + fi, err := osStat(src) + if err != nil { + return fmt.Errorf("failed to stat log file: %v", err) + } + + if err := chown(dst, fi); err != nil { + return fmt.Errorf("failed to chown compressed log file: %v", err) + } + + // If this file already exists, we presume it was created by + // a previous attempt to compress the log file. + gzf, err := os.OpenFile(dst, os.O_CREATE|os.O_TRUNC|os.O_WRONLY, fi.Mode()) + if err != nil { + return fmt.Errorf("failed to open compressed log file: %v", err) + } + defer gzf.Close() + + gz := gzip.NewWriter(gzf) + + defer func() { + if err != nil { + os.Remove(dst) + err = fmt.Errorf("failed to compress log file: %v", err) + } + }() + + if _, err := io.Copy(gz, f); err != nil { + return err + } + if err := gz.Close(); err != nil { + return err + } + if err := gzf.Close(); err != nil { + return err + } + + if err := f.Close(); err != nil { + return err + } + if err := os.Remove(src); err != nil { + return err + } + + return nil +} + +// logInfo is a convenience struct to return the filename and its embedded +// timestamp. +type logInfo struct { + timestamp time.Time + os.FileInfo +} + +// byFormatTime sorts by newest time formatted in the name. +type byFormatTime []logInfo + +func (b byFormatTime) Less(i, j int) bool { + return b[i].timestamp.After(b[j].timestamp) +} + +func (b byFormatTime) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b byFormatTime) Len() int { + return len(b) +} diff --git a/vendor/modules.txt b/vendor/modules.txt index 87673db339..cad5405ad8 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -420,6 +420,10 @@ github.com/coreos/stream-metadata-go/release github.com/coreos/stream-metadata-go/release/rhcos github.com/coreos/stream-metadata-go/stream github.com/coreos/stream-metadata-go/stream/rhcos +# github.com/crc-org/crc/v2 v2.32.0 +## explicit; go 1.20 +github.com/crc-org/crc/v2/pkg/crc/logging +github.com/crc-org/crc/v2/pkg/os # github.com/crc-org/vfkit v0.5.0 ## explicit; go 1.18 github.com/crc-org/vfkit/pkg/cmdline @@ -433,7 +437,7 @@ github.com/cyberphone/json-canonicalization/go/src/webpki.org/jsoncanonicalizer # github.com/cyphar/filepath-securejoin v0.2.4 ## explicit; go 1.13 github.com/cyphar/filepath-securejoin -# github.com/davecgh/go-spew v1.1.1 +# github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc ## explicit github.com/davecgh/go-spew/spew # github.com/digitalocean/go-libvirt v0.0.0-20220804181439-8648fbde413e @@ -720,7 +724,7 @@ github.com/klauspost/compress/internal/cpuinfo github.com/klauspost/compress/internal/snapref github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.5 +# github.com/klauspost/cpuid/v2 v2.2.6 ## explicit; go 1.15 github.com/klauspost/cpuid/v2 # github.com/klauspost/pgzip v1.2.6 @@ -758,6 +762,9 @@ github.com/mailru/easyjson/jwriter github.com/manifoldco/promptui github.com/manifoldco/promptui/list github.com/manifoldco/promptui/screenbuf +# github.com/mattn/go-colorable v0.1.13 +## explicit; go 1.15 +github.com/mattn/go-colorable # github.com/mattn/go-isatty v0.0.19 ## explicit; go 1.15 github.com/mattn/go-isatty @@ -927,7 +934,7 @@ github.com/pkg/errors ## explicit; go 1.15 github.com/pkg/sftp github.com/pkg/sftp/internal/encoding/ssh/filexfer -# github.com/pmezard/go-difflib v1.0.0 +# github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 ## explicit github.com/pmezard/go-difflib/difflib # github.com/power-devops/perfstat v0.0.0-20210106213030-5aafc221ea8c @@ -1366,6 +1373,9 @@ gopkg.in/go-jose/go-jose.v2/json # gopkg.in/inf.v0 v0.9.1 ## explicit gopkg.in/inf.v0 +# gopkg.in/natefinch/lumberjack.v2 v2.2.1 +## explicit; go 1.13 +gopkg.in/natefinch/lumberjack.v2 # gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 ## explicit gopkg.in/tomb.v1